SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O60259

- KLK8_HUMAN

UniProt

O60259 - KLK8_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Kallikrein-8

Gene
KLK8, NRPN, PRSS19, TADG14, UNQ283/PRO322
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.1 Publication

Catalytic activityi

Cleavage of amide substrates following the basic amino acids Arg or Lys at the P1 position, with a preference for Arg over Lys.1 Publication

Enzyme regulationi

Inhibited by a range of serine protease inhibitors including antipain, aprotinin, leupeptin, benzamidine and soybean trypsin inhibitor.1 Publication

Kineticsi

  1. KM=0.07 mM for Pro-Phe-Arg-MCA1 Publication
  2. KM=0.07 mM for Z-Val-Val-Arg-MCA
  3. KM=0.07 mM for Boc-Val-Pro-Arg-MCA
  4. KM=0.10 mM for Boc-Leu-Lys-Arg-MCA
  5. KM=0.10 mM for Boc-Val-Leu-Lys-MCA
  6. KM=0.07 mM for Boc-Phe-Ser-Arg-MCA

Vmax=7.1 µmol/min/mg enzyme toward Pro-Phe-Arg-MCA

Vmax=5.4 µmol/min/mg enzyme toward Z-Val-Val-Arg-MCA

Vmax=3.9 µmol/min/mg enzyme toward Boc-Val-Pro-Arg-MCA

Vmax=2.6 µmol/min/mg enzyme toward Boc-Leu-Lys-Arg-MCA

Vmax=1.9 µmol/min/mg enzyme toward Boc-Val-Leu-Lys-MCA

Vmax=1.6 µmol/min/mg enzyme toward Boc-Phe-Ser-Arg-MCA

pH dependencei

Optimum pH is 8.5. Active from pH 7-10.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei73 – 731Charge relay system By similarity
Active sitei120 – 1201Charge relay system By similarity
Active sitei212 – 2121Charge relay system By similarity

GO - Molecular functioni

  1. protein binding Source: UniProtKB
  2. serine-type endopeptidase activity Source: UniProtKB

GO - Biological processi

  1. cell death Source: UniProtKB
  2. keratinocyte proliferation Source: UniProtKB
  3. memory Source: UniProtKB
  4. negative regulation of axon regeneration Source: UniProtKB
  5. negative regulation of myelination Source: UniProtKB
  6. neuron projection morphogenesis Source: UniProtKB
  7. regulation of synapse organization Source: UniProtKB
  8. response to wounding Source: UniProtKB
  9. synapse organization Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Serine protease

Enzyme and pathway databases

BRENDAi3.4.21.118. 2681.

Protein family/group databases

MEROPSiS01.244.

Names & Taxonomyi

Protein namesi
Recommended name:
Kallikrein-8 (EC:3.4.21.118)
Short name:
hK8
Alternative name(s):
Neuropsin
Short name:
NP
Ovasin
Serine protease 19
Serine protease TADG-14
Tumor-associated differentially expressed gene 14 protein
Gene namesi
Name:KLK8
Synonyms:NRPN, PRSS19, TADG14
ORF Names:UNQ283/PRO322
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:6369. KLK8.

Subcellular locationi

Secreted. Cytoplasm
Note: Shows a cytoplasmic distribution in the keratinocytes.1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. extracellular space Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30158.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2828 Reviewed predictionAdd
BLAST
Propeptidei29 – 324 By similarityPRO_0000027946
Chaini33 – 260228Kallikrein-8PRO_0000027947Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi39 ↔ 173 By similarity
Disulfide bondi58 ↔ 74 By similarity
Glycosylationi110 – 1101N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi145 ↔ 246 By similarity
Disulfide bondi152 ↔ 218 By similarity
Disulfide bondi184 ↔ 198 By similarity
Disulfide bondi208 ↔ 233 By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

PaxDbiO60259.
PRIDEiO60259.

PTM databases

PhosphoSiteiO60259.

Expressioni

Tissue specificityi

Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and kidney but not in spleen, liver, lung or normal ovarian tissue. Displays an 11.5-fold increase in Alzheimer disease hippocampus compared to controls and is overexpressed in some ovarian carcinomas. Expressed at low levels in normal skin while high levels are found in psoriasis vulgaris, seborrheic keratosis, lichen planus and squamous cell carcinoma skin samples. Expressed in the keratinocytes.4 Publications

Gene expression databases

ArrayExpressiO60259.
BgeeiO60259.
GenevestigatoriO60259.

Organism-specific databases

HPAiCAB019393.

Interactioni

Subunit structurei

Interacts with SPINK9.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ZDHHC17Q8IUH53EBI-3915857,EBI-524753

Protein-protein interaction databases

BioGridi116371. 1 interaction.
IntActiO60259. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliO60259.
SMRiO60259. Positions 33-256.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini33 – 257225Peptidase S1Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG5640.
HOVERGENiHBG013304.
KOiK08650.
OMAiTKLYAEN.
OrthoDBiEOG75B84T.
PhylomeDBiO60259.
TreeFamiTF331065.

Family and domain databases

InterProiIPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O60259-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGRPRPRAAK TWMFLLLLGG AWAGHSRAQE DKVLGGHECQ PHSQPWQAAL    50
FQGQQLLCGG VLVGGNWVLT AAHCKKPKYT VRLGDHSLQN KDGPEQEIPV 100
VQSIPHPCYN SSDVEDHNHD LMLLQLRDQA SLGSKVKPIS LADHCTQPGQ 150
KCTVSGWGTV TSPRENFPDT LNCAEVKIFP QKKCEDAYPG QITDGMVCAG 200
SSKGADTCQG DSGGPLVCDG ALQGITSWGS DPCGRSDKPG VYTNICRYLD 250
WIKKIIGSKG 260
Length:260
Mass (Da):28,048
Last modified:August 1, 1998 - v1
Checksum:iEF439E5B8C83E660
GO
Isoform 2 (identifier: O60259-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     23-23: A → AACGSLDLLTKLYAENLPCVHLNPQWPSQPSHCPRGWRSNPLPPAA

Note: Produced as a result of a human-specific mutation which is not found in other primates.

Show »
Length:305
Mass (Da):32,966
Checksum:i2972CED7B2706AF0
GO
Isoform 3 (identifier: O60259-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-164: Missing.

Show »
Length:119
Mass (Da):12,719
Checksum:i2FD8164DF1641FFF
GO
Isoform 4 (identifier: O60259-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-32: HSRAQEDK → RFWRPPGV
     33-260: Missing.

Show »
Length:32
Mass (Da):3,653
Checksum:i905DA8F5F9C8A664
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti154 – 1541V → I.
Corresponds to variant rs16988799 [ dbSNP | Ensembl ].
VAR_051855

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei23 – 231A → AACGSLDLLTKLYAENLPCV HLNPQWPSQPSHCPRGWRSN PLPPAA in isoform 2. VSP_005401
Alternative sequencei24 – 164141Missing in isoform 3. VSP_030350Add
BLAST
Alternative sequencei25 – 328HSRAQEDK → RFWRPPGV in isoform 4. VSP_030351
Alternative sequencei33 – 260228Missing in isoform 4. VSP_030352Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti195 – 1951G → V in AAH40887. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009849 mRNA. Translation: BAA28673.1.
AB012761 Genomic DNA. Translation: BAA28676.1.
AF055982 mRNA. Translation: AAD56050.1.
AB008390 mRNA. Translation: BAA82665.1.
AB008927 mRNA. Translation: BAA82666.1.
AB010780 Genomic DNA. Translation: BAA88684.1.
AF243527 Genomic DNA. Translation: AAG33361.1.
AF251125 Genomic DNA. Translation: AAF79144.1.
AF251125 Genomic DNA. Translation: AAF79145.1.
AF095742 mRNA. Translation: AAD25979.1.
AF095743 Genomic DNA. Translation: AAD29574.1.
DQ267420 mRNA. Translation: ABB83339.1.
AY359036 mRNA. Translation: AAQ89395.1.
AC011473 Genomic DNA. Translation: AAG23254.1.
AC011483 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW71962.1.
BC040887 mRNA. Translation: AAH40887.1.
AY563055 Genomic DNA. Translation: AAT76913.1.
AY563055 Genomic DNA. Translation: AAT76914.1.
AY563056 Genomic DNA. Translation: AAT76915.1.
AY563056 Genomic DNA. Translation: AAT76916.1.
AY563057 Genomic DNA. Translation: AAT76917.1.
AY563057 Genomic DNA. Translation: AAT76918.1.
AY563058 Genomic DNA. Translation: AAT76919.1.
AY563058 Genomic DNA. Translation: AAT76920.1.
AY563059 Genomic DNA. Translation: AAT76921.1.
AY563059 Genomic DNA. Translation: AAT76922.1.
AY563060 Genomic DNA. Translation: AAT76923.1.
AY563060 Genomic DNA. Translation: AAT76924.1.
AY563061 Genomic DNA. Translation: AAT76925.1.
AY563061 Genomic DNA. Translation: AAT76926.1.
AY563062 Genomic DNA. Translation: AAT76927.1.
AY563062 Genomic DNA. Translation: AAT76928.1.
AY563063 Genomic DNA. Translation: AAT76929.1.
AY563063 Genomic DNA. Translation: AAT76930.1.
AY563064 Genomic DNA. Translation: AAT76931.1.
AY563064 Genomic DNA. Translation: AAT76932.1.
AY563065 Genomic DNA. Translation: AAT76933.1.
AY563065 Genomic DNA. Translation: AAT76934.1.
AY563066 Genomic DNA. Translation: AAT76935.1.
AY563066 Genomic DNA. Translation: AAT76936.1.
AY563067 Genomic DNA. Translation: AAT76937.1.
AY563067 Genomic DNA. Translation: AAT76938.1.
CCDSiCCDS12813.1. [O60259-1]
CCDS12814.1. [O60259-3]
CCDS12815.1. [O60259-4]
CCDS42600.1. [O60259-2]
RefSeqiNP_001268360.1. NM_001281431.1.
NP_009127.1. NM_007196.3. [O60259-1]
NP_653088.1. NM_144505.2. [O60259-2]
NP_653089.1. NM_144506.2. [O60259-3]
NP_653090.1. NM_144507.2. [O60259-4]
UniGeneiHs.104570.

Genome annotation databases

EnsembliENST00000291726; ENSP00000291726; ENSG00000129455. [O60259-1]
ENST00000320838; ENSP00000325072; ENSG00000129455. [O60259-4]
ENST00000347619; ENSP00000341555; ENSG00000129455. [O60259-3]
ENST00000391806; ENSP00000375682; ENSG00000129455. [O60259-2]
ENST00000593490; ENSP00000469278; ENSG00000129455. [O60259-4]
ENST00000600767; ENSP00000472016; ENSG00000129455. [O60259-1]
GeneIDi11202.
KEGGihsa:11202.
UCSCiuc002puq.1. human. [O60259-2]
uc002pur.1. human. [O60259-1]
uc002pus.1. human. [O60259-3]
uc002put.1. human. [O60259-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009849 mRNA. Translation: BAA28673.1 .
AB012761 Genomic DNA. Translation: BAA28676.1 .
AF055982 mRNA. Translation: AAD56050.1 .
AB008390 mRNA. Translation: BAA82665.1 .
AB008927 mRNA. Translation: BAA82666.1 .
AB010780 Genomic DNA. Translation: BAA88684.1 .
AF243527 Genomic DNA. Translation: AAG33361.1 .
AF251125 Genomic DNA. Translation: AAF79144.1 .
AF251125 Genomic DNA. Translation: AAF79145.1 .
AF095742 mRNA. Translation: AAD25979.1 .
AF095743 Genomic DNA. Translation: AAD29574.1 .
DQ267420 mRNA. Translation: ABB83339.1 .
AY359036 mRNA. Translation: AAQ89395.1 .
AC011473 Genomic DNA. Translation: AAG23254.1 .
AC011483 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW71962.1 .
BC040887 mRNA. Translation: AAH40887.1 .
AY563055 Genomic DNA. Translation: AAT76913.1 .
AY563055 Genomic DNA. Translation: AAT76914.1 .
AY563056 Genomic DNA. Translation: AAT76915.1 .
AY563056 Genomic DNA. Translation: AAT76916.1 .
AY563057 Genomic DNA. Translation: AAT76917.1 .
AY563057 Genomic DNA. Translation: AAT76918.1 .
AY563058 Genomic DNA. Translation: AAT76919.1 .
AY563058 Genomic DNA. Translation: AAT76920.1 .
AY563059 Genomic DNA. Translation: AAT76921.1 .
AY563059 Genomic DNA. Translation: AAT76922.1 .
AY563060 Genomic DNA. Translation: AAT76923.1 .
AY563060 Genomic DNA. Translation: AAT76924.1 .
AY563061 Genomic DNA. Translation: AAT76925.1 .
AY563061 Genomic DNA. Translation: AAT76926.1 .
AY563062 Genomic DNA. Translation: AAT76927.1 .
AY563062 Genomic DNA. Translation: AAT76928.1 .
AY563063 Genomic DNA. Translation: AAT76929.1 .
AY563063 Genomic DNA. Translation: AAT76930.1 .
AY563064 Genomic DNA. Translation: AAT76931.1 .
AY563064 Genomic DNA. Translation: AAT76932.1 .
AY563065 Genomic DNA. Translation: AAT76933.1 .
AY563065 Genomic DNA. Translation: AAT76934.1 .
AY563066 Genomic DNA. Translation: AAT76935.1 .
AY563066 Genomic DNA. Translation: AAT76936.1 .
AY563067 Genomic DNA. Translation: AAT76937.1 .
AY563067 Genomic DNA. Translation: AAT76938.1 .
CCDSi CCDS12813.1. [O60259-1 ]
CCDS12814.1. [O60259-3 ]
CCDS12815.1. [O60259-4 ]
CCDS42600.1. [O60259-2 ]
RefSeqi NP_001268360.1. NM_001281431.1.
NP_009127.1. NM_007196.3. [O60259-1 ]
NP_653088.1. NM_144505.2. [O60259-2 ]
NP_653089.1. NM_144506.2. [O60259-3 ]
NP_653090.1. NM_144507.2. [O60259-4 ]
UniGenei Hs.104570.

3D structure databases

ProteinModelPortali O60259.
SMRi O60259. Positions 33-256.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116371. 1 interaction.
IntActi O60259. 2 interactions.

Chemistry

BindingDBi O60259.
ChEMBLi CHEMBL4812.

Protein family/group databases

MEROPSi S01.244.

PTM databases

PhosphoSitei O60259.

Proteomic databases

PaxDbi O60259.
PRIDEi O60259.

Protocols and materials databases

DNASUi 11202.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000291726 ; ENSP00000291726 ; ENSG00000129455 . [O60259-1 ]
ENST00000320838 ; ENSP00000325072 ; ENSG00000129455 . [O60259-4 ]
ENST00000347619 ; ENSP00000341555 ; ENSG00000129455 . [O60259-3 ]
ENST00000391806 ; ENSP00000375682 ; ENSG00000129455 . [O60259-2 ]
ENST00000593490 ; ENSP00000469278 ; ENSG00000129455 . [O60259-4 ]
ENST00000600767 ; ENSP00000472016 ; ENSG00000129455 . [O60259-1 ]
GeneIDi 11202.
KEGGi hsa:11202.
UCSCi uc002puq.1. human. [O60259-2 ]
uc002pur.1. human. [O60259-1 ]
uc002pus.1. human. [O60259-3 ]
uc002put.1. human. [O60259-4 ]

Organism-specific databases

CTDi 11202.
GeneCardsi GC19M051499.
HGNCi HGNC:6369. KLK8.
HPAi CAB019393.
MIMi 605644. gene.
neXtProti NX_O60259.
PharmGKBi PA30158.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5640.
HOVERGENi HBG013304.
KOi K08650.
OMAi TKLYAEN.
OrthoDBi EOG75B84T.
PhylomeDBi O60259.
TreeFami TF331065.

Enzyme and pathway databases

BRENDAi 3.4.21.118. 2681.

Miscellaneous databases

GeneWikii KLK8.
GenomeRNAii 11202.
NextBioi 42641.
PROi O60259.
SOURCEi Search...

Gene expression databases

ArrayExpressi O60259.
Bgeei O60259.
Genevestigatori O60259.

Family and domain databases

InterProi IPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view ]
Pfami PF00089. Trypsin. 1 hit.
[Graphical view ]
PRINTSi PR00722. CHYMOTRYPSIN.
SMARTi SM00020. Tryp_SPc. 1 hit.
[Graphical view ]
SUPFAMi SSF50494. SSF50494. 1 hit.
PROSITEi PS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence analysis and expression of human neuropsin cDNA and gene."
    Yoshida S., Taniguchi M., Hirata A., Shiosaka S.
    Gene 213:9-16(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
    Tissue: Hippocampus.
  2. "Cloning of tumor-associated differentially expressed gene-14, a novel serine protease overexpressed by ovarian carcinoma."
    Underwood L.J., Tanimoto H., Wang Y., Shigemasa K., Parmley T.H., O'Brien T.J.
    Cancer Res. 59:4435-4439(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Ovary.
  3. "A novel form of human neuropsin, a brain-related serine protease, is generated by alternative splicing and is expressed preferentially in human adult brain."
    Mitsui S., Tsuruoka N., Yamashiro K., Nakazato H., Yamaguchi N.
    Eur. J. Biochem. 260:627-634(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  4. "Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region."
    Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K.
    Gene 257:119-130(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. "The human KLK8 (neuropsin/ovasin) gene: identification of two novel splice variants and its prognostic value in ovarian cancer."
    Magklara A., Scorilas A., Katsaros D., Massobrio M., Yousef G.M., Fracchioli S., Danese S., Diamandis E.P.
    Clin. Cancer Res. 7:806-811(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 3 AND 4), TISSUE SPECIFICITY.
  6. "Molecular cloning and characterization of a novel serine protease, ovasin, a potential molecular marker for ovarian carcinomas."
    Gan L., Gelinas R., Gown A.M., Moss P., Smith R., Wang K.
    Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
  7. "Human kallikrein 8 and human kallikrein 9 are organized as a bicistronic operon."
    Michael I.P., Diamandis E.P.
    Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  9. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  12. "Recent origin of a hominoid-specific splice form of neuropsin, a gene involved in learning and memory."
    Li Y., Qian Y.-P., Yu X.-J., Wang Y.-Q., Dong D.-G., Sun W., Ma R.-M., Su B.
    Mol. Biol. Evol. 21:2111-2115(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
  13. "Expression of the kallikrein gene family in normal and Alzheimer's disease brain."
    Shimizu-Okabe C., Yousef G.M., Diamandis E.P., Yoshida S., Shiosaka S., Fahnestock M.
    NeuroReport 12:2747-2751(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  14. "Epidermal expression of serine protease, neuropsin (KLK8) in normal and pathological skin samples."
    Kuwae K., Matsumoto-Miyai K., Yoshida S., Sadayama T., Yoshikawa K., Hosokawa K., Shiosaka S.
    Mol. Pathol. 55:235-241(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  15. "Human kallikrein 8, a novel biomarker for ovarian carcinoma."
    Kishi T., Grass L., Soosaipillai A., Scorilas A., Harbeck N., Schmalfeldt B., Dorn J., Mysliwiec M., Schmitt M., Diamandis E.P.
    Cancer Res. 63:2771-2774(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: USE AS A MARKER FOR OVARIAN CANCER.
  16. "Biochemical characterization of human kallikrein 8 and its possible involvement in the degradation of extracellular matrix proteins."
    Rajapakse S., Ogiwara K., Takano N., Moriyama A., Takahashi T.
    FEBS Lett. 579:6879-6884(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES.
  17. "A human-specific mutation leads to the origin of a novel splice form of neuropsin (KLK8), a gene involved in learning and memory."
    Lu Z.-X., Peng J., Su B.
    Hum. Mutat. 28:978-984(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORM 2).
  18. "SerpinB6 is an inhibitor of kallikrein-8 in keratinocytes."
    Scott F.L., Sun J., Whisstock J.C., Kato K., Bird P.I.
    J. Biochem. 142:435-442(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  19. "SPINK9: a selective, skin-specific Kazal-type serine protease inhibitor."
    Brattsand M., Stefansson K., Hubiche T., Nilsson S.K., Egelrud T.
    J. Invest. Dermatol. 129:1656-1665(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SPINK9.

Entry informationi

Entry nameiKLK8_HUMAN
AccessioniPrimary (citable) accession number: O60259
Secondary accession number(s): Q5V9X1
, Q5V9X2, Q8IW69, Q9HCB3, Q9NR68, Q9NR69, Q9UIL9, Q9UQ47
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: August 1, 1998
Last modified: July 9, 2014
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Expressed at high levels in serum, ascites fluid and tumor cytosol of advanced stage ovarian cancer patients and may serve as a marker of ovarian cancer.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi