O60259 (KLK8_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Kallikrein-8 Short name=hK8 EC=3.4.21.118 Alternative name(s): Neuropsin Short name=NP Ovasin Serine protease 19 Serine protease TADG-14 Tumor-associated differentially expressed gene 14 protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 260 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury. Ref.16 |
| Catalytic activity | Cleavage of amide substrates following the basic amino acids Arg or Lys at the P1 position, with a preference for Arg over Lys. Ref.16 |
| Enzyme regulation | Inhibited by a range of serine protease inhibitors including antipain, aprotinin, leupeptin, benzamidine and soybean trypsin inhibitor. Ref.16 |
| Subunit structure | Interacts with SPINK9. Ref.19 |
| Subcellular location | Secreted. Cytoplasm. Note: Shows a cytoplasmic distribution in the keratinocytes. Ref.18 |
| Tissue specificity | Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and kidney but not in spleen, liver, lung or normal ovarian tissue. Displays an 11.5-fold increase in Alzheimer disease hippocampus compared to controls and is overexpressed in some ovarian carcinomas. Expressed at low levels in normal skin while high levels are found in psoriasis vulgaris, seborrheic keratosis, lichen planus and squamous cell carcinoma skin samples. Expressed in the keratinocytes. Ref.5 Ref.13 Ref.14 Ref.18 |
| Miscellaneous | Expressed at high levels in serum, ascites fluid and tumor cytosol of advanced stage ovarian cancer patients and may serve as a marker of ovarian cancer. |
| Sequence similarities | Belongs to the peptidase S1 family. Kallikrein subfamily. Contains 1 peptidase S1 domain. |
| Biophysicochemical properties | Kinetic parameters: KM=0.07 mM for Pro-Phe-Arg-MCA Ref.16 KM=0.07 mM for Z-Val-Val-Arg-MCA KM=0.07 mM for Boc-Val-Pro-Arg-MCA KM=0.10 mM for Boc-Leu-Lys-Arg-MCA KM=0.10 mM for Boc-Val-Leu-Lys-MCA KM=0.07 mM for Boc-Phe-Ser-Arg-MCA Vmax=7.1 µmol/min/mg enzyme toward Pro-Phe-Arg-MCA Vmax=5.4 µmol/min/mg enzyme toward Z-Val-Val-Arg-MCA Vmax=3.9 µmol/min/mg enzyme toward Boc-Val-Pro-Arg-MCA Vmax=2.6 µmol/min/mg enzyme toward Boc-Leu-Lys-Arg-MCA Vmax=1.9 µmol/min/mg enzyme toward Boc-Val-Leu-Lys-MCA Vmax=1.6 µmol/min/mg enzyme toward Boc-Phe-Ser-Arg-MCA pH dependence: Optimum pH is 8.5. Active from pH 7-10. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O60259-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O60259-2) The sequence of this isoform differs from the canonical sequence as follows: 23-23: A → AACGSLDLLTKLYAENLPCVHLNPQWPSQPSHCPRGWRSNPLPPAA | ||||||
| Note: Produced as a result of a human-specific mutation which is not found in other primates. | ||||||
| Isoform 3 (identifier: O60259-3) The sequence of this isoform differs from the canonical sequence as follows: 24-164: Missing. | ||||||
| Isoform 4 (identifier: O60259-4) The sequence of this isoform differs from the canonical sequence as follows: 25-32: HSRAQEDK → RFWRPPGV 33-260: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 28 | 28 | Potential | ||||||||
| Propeptide | 29 – 32 | 4 | By similarity | PRO_0000027946 | |||||||
| Chain | 33 – 260 | 228 | Kallikrein-8 | PRO_0000027947 | |||||||
Regions | |||||||||||
| Domain | 33 – 257 | 225 | Peptidase S1 | ||||||||
Sites | |||||||||||
| Active site | 73 | 1 | Charge relay system By similarity | ||||||||
| Active site | 120 | 1 | Charge relay system By similarity | ||||||||
| Active site | 212 | 1 | Charge relay system By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 110 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 39 ↔ 173 | By similarity | |||||||||
| Disulfide bond | 58 ↔ 74 | By similarity | |||||||||
| Disulfide bond | 145 ↔ 246 | By similarity | |||||||||
| Disulfide bond | 152 ↔ 218 | By similarity | |||||||||
| Disulfide bond | 184 ↔ 198 | By similarity | |||||||||
| Disulfide bond | 208 ↔ 233 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 23 | 1 | A → AACGSLDLLTKLYAENLPCV HLNPQWPSQPSHCPRGWRSN PLPPAA in isoform 2. | VSP_005401 | |||||||
| Alternative sequence | 24 – 164 | 141 | Missing in isoform 3. | VSP_030350 | |||||||
| Alternative sequence | 25 – 32 | 8 | HSRAQEDK → RFWRPPGV in isoform 4. | VSP_030351 | |||||||
| Alternative sequence | 33 – 260 | 228 | Missing in isoform 4. | VSP_030352 | |||||||
| Natural variant | 154 | 1 | V → I. Corresponds to variant rs16988799 [ dbSNP | Ensembl ]. | VAR_051855 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 195 | 1 | G → V in AAH40887. Ref.11 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence analysis and expression of human neuropsin cDNA and gene." Yoshida S., Taniguchi M., Hirata A., Shiosaka S. Gene 213:9-16(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1). Tissue: Hippocampus. |
| [2] | "Cloning of tumor-associated differentially expressed gene-14, a novel serine protease overexpressed by ovarian carcinoma." Underwood L.J., Tanimoto H., Wang Y., Shigemasa K., Parmley T.H., O'Brien T.J. Cancer Res. 59:4435-4439(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Ovary. |
| [3] | "A novel form of human neuropsin, a brain-related serine protease, is generated by alternative splicing and is expressed preferentially in human adult brain." Mitsui S., Tsuruoka N., Yamashiro K., Nakazato H., Yamaguchi N. Eur. J. Biochem. 260:627-634(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [4] | "Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region." Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K. Gene 257:119-130(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "The human KLK8 (neuropsin/ovasin) gene: identification of two novel splice variants and its prognostic value in ovarian cancer." Magklara A., Scorilas A., Katsaros D., Massobrio M., Yousef G.M., Fracchioli S., Danese S., Diamandis E.P. Clin. Cancer Res. 7:806-811(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 3 AND 4), TISSUE SPECIFICITY. |
| [6] | "Molecular cloning and characterization of a novel serine protease, ovasin, a potential molecular marker for ovarian carcinomas." Gan L., Gelinas R., Gown A.M., Moss P., Smith R., Wang K. Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1). |
| [7] | "Human kallikrein 8 and human kallikrein 9 are organized as a bicistronic operon." Michael I.P., Diamandis E.P. Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [8] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [9] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [12] | "Recent origin of a hominoid-specific splice form of neuropsin, a gene involved in learning and memory." Li Y., Qian Y.-P., Yu X.-J., Wang Y.-Q., Dong D.-G., Sun W., Ma R.-M., Su B. Mol. Biol. Evol. 21:2111-2115(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2). |
| [13] | "Expression of the kallikrein gene family in normal and Alzheimer's disease brain." Shimizu-Okabe C., Yousef G.M., Diamandis E.P., Yoshida S., Shiosaka S., Fahnestock M. NeuroReport 12:2747-2751(2001) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [14] | "Epidermal expression of serine protease, neuropsin (KLK8) in normal and pathological skin samples." Kuwae K., Matsumoto-Miyai K., Yoshida S., Sadayama T., Yoshikawa K., Hosokawa K., Shiosaka S. Mol. Pathol. 55:235-241(2002) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [15] | "Human kallikrein 8, a novel biomarker for ovarian carcinoma." Kishi T., Grass L., Soosaipillai A., Scorilas A., Harbeck N., Schmalfeldt B., Dorn J., Mysliwiec M., Schmitt M., Diamandis E.P. Cancer Res. 63:2771-2774(2003) [PubMed] [Europe PMC] [Abstract] Cited for: USE AS A MARKER FOR OVARIAN CANCER. |
| [16] | "Biochemical characterization of human kallikrein 8 and its possible involvement in the degradation of extracellular matrix proteins." Rajapakse S., Ogiwara K., Takano N., Moriyama A., Takahashi T. FEBS Lett. 579:6879-6884(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES. |
| [17] | "A human-specific mutation leads to the origin of a novel splice form of neuropsin (KLK8), a gene involved in learning and memory." Lu Z.-X., Peng J., Su B. Hum. Mutat. 28:978-984(2007) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 2). |
| [18] | "SerpinB6 is an inhibitor of kallikrein-8 in keratinocytes." Scott F.L., Sun J., Whisstock J.C., Kato K., Bird P.I. J. Biochem. 142:435-442(2007) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [19] | "SPINK9: a selective, skin-specific Kazal-type serine protease inhibitor." Brattsand M., Stefansson K., Hubiche T., Nilsson S.K., Egelrud T. J. Invest. Dermatol. 129:1656-1665(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SPINK9. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB009849 mRNA. Translation: BAA28673.1. AB012761 Genomic DNA. Translation: BAA28676.1. AF055982 mRNA. Translation: AAD56050.1. AB008390 mRNA. Translation: BAA82665.1. AB008927 mRNA. Translation: BAA82666.1. AB010780 Genomic DNA. Translation: BAA88684.1. AF243527 Genomic DNA. Translation: AAG33361.1. AF251125 Genomic DNA. Translation: AAF79144.1. AF251125 Genomic DNA. Translation: AAF79145.1. AF095742 mRNA. Translation: AAD25979.1. AF095743 Genomic DNA. Translation: AAD29574.1. DQ267420 mRNA. Translation: ABB83339.1. AY359036 mRNA. Translation: AAQ89395.1. AC011473 Genomic DNA. Translation: AAG23254.1. AC011483 Genomic DNA. No translation available. CH471135 Genomic DNA. Translation: EAW71962.1. BC040887 mRNA. Translation: AAH40887.1. AY563055 Genomic DNA. Translation: AAT76913.1. AY563055 Genomic DNA. Translation: AAT76914.1. AY563056 Genomic DNA. Translation: AAT76915.1. AY563056 Genomic DNA. Translation: AAT76916.1. AY563057 Genomic DNA. Translation: AAT76917.1. AY563057 Genomic DNA. Translation: AAT76918.1. AY563058 Genomic DNA. Translation: AAT76919.1. AY563058 Genomic DNA. Translation: AAT76920.1. AY563059 Genomic DNA. Translation: AAT76921.1. AY563059 Genomic DNA. Translation: AAT76922.1. AY563060 Genomic DNA. Translation: AAT76923.1. AY563060 Genomic DNA. Translation: AAT76924.1. AY563061 Genomic DNA. Translation: AAT76925.1. AY563061 Genomic DNA. Translation: AAT76926.1. AY563062 Genomic DNA. Translation: AAT76927.1. AY563062 Genomic DNA. Translation: AAT76928.1. AY563063 Genomic DNA. Translation: AAT76929.1. AY563063 Genomic DNA. Translation: AAT76930.1. AY563064 Genomic DNA. Translation: AAT76931.1. AY563064 Genomic DNA. Translation: AAT76932.1. AY563065 Genomic DNA. Translation: AAT76933.1. AY563065 Genomic DNA. Translation: AAT76934.1. AY563066 Genomic DNA. Translation: AAT76935.1. AY563066 Genomic DNA. Translation: AAT76936.1. AY563067 Genomic DNA. Translation: AAT76937.1. AY563067 Genomic DNA. Translation: AAT76938.1. |
| IPI | IPI00016000. IPI00016041. IPI00028484. IPI00219892. |
| RefSeq | NP_009127.1. NM_007196.2. NP_653088.1. NM_144505.1. NP_653089.1. NM_144506.1. NP_653090.1. NM_144507.1. |
| UniGene | Hs.104570. |
3D structure databases | |
| ProteinModelPortal | O60259. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O60259. 1 interaction. |
Protein family/group databases | |
| MEROPS | S01.244. |
PTM databases | |
| PhosphoSite | O60259. |
Proteomic databases | |
| PaxDb | O60259. |
| PRIDE | O60259. |
Protocols and materials databases | |
| DNASU | 11202. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000291726; ENSP00000291726; ENSG00000129455. ENST00000320838; ENSP00000325072; ENSG00000129455. ENST00000347619; ENSP00000341555; ENSG00000129455. ENST00000391806; ENSP00000375682; ENSG00000129455. ENST00000593490; ENSP00000469278; ENSG00000129455. ENST00000600767; ENSP00000472016; ENSG00000129455. |
| GeneID | 11202. |
| KEGG | hsa:11202. |
| UCSC | uc002puq.1. human. uc002pur.1. human. uc002pus.1. human. uc002put.1. human. |
Organism-specific databases | |
| CTD | 11202. |
| GeneCards | GC19M051499. |
| HGNC | HGNC:6369. KLK8. |
| HPA | CAB019393. |
| MIM | 605644. gene. |
| neXtProt | NX_O60259. |
| PharmGKB | PA30158. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5640. |
| HOVERGEN | HBG013304. |
| KO | K08650. |
| OMA | TKLYAEN. |
| PhylomeDB | O60259. |
Enzyme and pathway databases | |
| BRENDA | 3.4.21.118. 2681. |
Gene expression databases | |
| ArrayExpress | O60259. |
| Bgee | O60259. |
| Genevestigator | O60259. |
| GermOnline | ENSG00000129455. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001254. Peptidase_S1. IPR018114. Peptidase_S1_AS. IPR001314. Peptidase_S1A. IPR009003. Trypsin-like_Pept_dom. [Graphical view] |
| Pfam | PF00089. Trypsin. 1 hit. [Graphical view] |
| PRINTS | PR00722. CHYMOTRYPSIN. |
| SMART | SM00020. Tryp_SPc. 1 hit. [Graphical view] |
| SUPFAM | SSF50494. Pept_Ser_Cys. 1 hit. |
| PROSITE | PS50240. TRYPSIN_DOM. 1 hit. PS00134. TRYPSIN_HIS. 1 hit. PS00135. TRYPSIN_SER. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | O60259. |
| ChEMBL | CHEMBL4812. |
| GenomeRNAi | 11202. |
| NextBio | 42641. |
| SOURCE | Search... |
Entry information
| Entry name | KLK8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O60259 Secondary accession number(s): Q5V9X1 Q9UQ47 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
