Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O60259 (KLK8_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 134. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Kallikrein-8

Short name=hK8
EC=3.4.21.118
Alternative name(s):
Neuropsin
Short name=NP
Ovasin
Serine protease 19
Serine protease TADG-14
Tumor-associated differentially expressed gene 14 protein
Gene names
Name:KLK8
Synonyms:NRPN, PRSS19, TADG14
ORF Names:UNQ283/PRO322
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length260 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury. Ref.16

Catalytic activity

Cleavage of amide substrates following the basic amino acids Arg or Lys at the P1 position, with a preference for Arg over Lys. Ref.16

Enzyme regulation

Inhibited by a range of serine protease inhibitors including antipain, aprotinin, leupeptin, benzamidine and soybean trypsin inhibitor. Ref.16

Subunit structure

Interacts with SPINK9. Ref.19

Subcellular location

Secreted. Cytoplasm. Note: Shows a cytoplasmic distribution in the keratinocytes. Ref.18

Tissue specificity

Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and kidney but not in spleen, liver, lung or normal ovarian tissue. Displays an 11.5-fold increase in Alzheimer disease hippocampus compared to controls and is overexpressed in some ovarian carcinomas. Expressed at low levels in normal skin while high levels are found in psoriasis vulgaris, seborrheic keratosis, lichen planus and squamous cell carcinoma skin samples. Expressed in the keratinocytes. Ref.5 Ref.13 Ref.14 Ref.18

Miscellaneous

Expressed at high levels in serum, ascites fluid and tumor cytosol of advanced stage ovarian cancer patients and may serve as a marker of ovarian cancer.

Sequence similarities

Belongs to the peptidase S1 family. Kallikrein subfamily.

Contains 1 peptidase S1 domain.

Biophysicochemical properties

Kinetic parameters:

KM=0.07 mM for Pro-Phe-Arg-MCA Ref.16

KM=0.07 mM for Z-Val-Val-Arg-MCA

KM=0.07 mM for Boc-Val-Pro-Arg-MCA

KM=0.10 mM for Boc-Leu-Lys-Arg-MCA

KM=0.10 mM for Boc-Val-Leu-Lys-MCA

KM=0.07 mM for Boc-Phe-Ser-Arg-MCA

Vmax=7.1 µmol/min/mg enzyme toward Pro-Phe-Arg-MCA

Vmax=5.4 µmol/min/mg enzyme toward Z-Val-Val-Arg-MCA

Vmax=3.9 µmol/min/mg enzyme toward Boc-Val-Pro-Arg-MCA

Vmax=2.6 µmol/min/mg enzyme toward Boc-Leu-Lys-Arg-MCA

Vmax=1.9 µmol/min/mg enzyme toward Boc-Val-Leu-Lys-MCA

Vmax=1.6 µmol/min/mg enzyme toward Boc-Phe-Ser-Arg-MCA

pH dependence:

Optimum pH is 8.5. Active from pH 7-10.

Ontologies

Keywords
   Cellular componentCytoplasm
Secreted
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal
   Molecular functionHydrolase
Protease
Serine protease
   PTMDisulfide bond
Glycoprotein
Zymogen
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell death

Inferred from sequence or structural similarity. Source: UniProtKB

keratinocyte proliferation

Inferred from sequence or structural similarity. Source: UniProtKB

memory

Inferred from sequence or structural similarity. Source: UniProtKB

negative regulation of axon regeneration

Inferred from sequence or structural similarity. Source: UniProtKB

negative regulation of myelination

Inferred from sequence or structural similarity. Source: UniProtKB

neuron projection morphogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

regulation of synapse organization

Inferred from sequence or structural similarity. Source: UniProtKB

response to wounding

Inferred from sequence or structural similarity. Source: UniProtKB

synapse organization

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcytoplasm

Inferred from direct assay Ref.18. Source: UniProtKB

extracellular space

Inferred from sequence or structural similarity. Source: UniProtKB

   Molecular_functionprotein binding

Inferred from physical interaction Ref.19. Source: UniProtKB

serine-type endopeptidase activity

Inferred from direct assay Ref.16. Source: UniProtKB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

ZDHHC17Q8IUH53EBI-3915857,EBI-524753

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O60259-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O60259-2)

The sequence of this isoform differs from the canonical sequence as follows:
     23-23: A → AACGSLDLLTKLYAENLPCVHLNPQWPSQPSHCPRGWRSNPLPPAA
Note: Produced as a result of a human-specific mutation which is not found in other primates.
Isoform 3 (identifier: O60259-3)

The sequence of this isoform differs from the canonical sequence as follows:
     24-164: Missing.
Isoform 4 (identifier: O60259-4)

The sequence of this isoform differs from the canonical sequence as follows:
     25-32: HSRAQEDK → RFWRPPGV
     33-260: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2828 Potential
Propeptide29 – 324 By similarity
PRO_0000027946
Chain33 – 260228Kallikrein-8
PRO_0000027947

Regions

Domain33 – 257225Peptidase S1

Sites

Active site731Charge relay system By similarity
Active site1201Charge relay system By similarity
Active site2121Charge relay system By similarity

Amino acid modifications

Glycosylation1101N-linked (GlcNAc...) Potential
Disulfide bond39 ↔ 173 By similarity
Disulfide bond58 ↔ 74 By similarity
Disulfide bond145 ↔ 246 By similarity
Disulfide bond152 ↔ 218 By similarity
Disulfide bond184 ↔ 198 By similarity
Disulfide bond208 ↔ 233 By similarity

Natural variations

Alternative sequence231A → AACGSLDLLTKLYAENLPCV HLNPQWPSQPSHCPRGWRSN PLPPAA in isoform 2.
VSP_005401
Alternative sequence24 – 164141Missing in isoform 3.
VSP_030350
Alternative sequence25 – 328HSRAQEDK → RFWRPPGV in isoform 4.
VSP_030351
Alternative sequence33 – 260228Missing in isoform 4.
VSP_030352
Natural variant1541V → I.
Corresponds to variant rs16988799 [ dbSNP | Ensembl ].
VAR_051855

Experimental info

Sequence conflict1951G → V in AAH40887. Ref.11

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified August 1, 1998. Version 1.
Checksum: EF439E5B8C83E660

FASTA26028,048
        10         20         30         40         50         60 
MGRPRPRAAK TWMFLLLLGG AWAGHSRAQE DKVLGGHECQ PHSQPWQAAL FQGQQLLCGG 

        70         80         90        100        110        120 
VLVGGNWVLT AAHCKKPKYT VRLGDHSLQN KDGPEQEIPV VQSIPHPCYN SSDVEDHNHD 

       130        140        150        160        170        180 
LMLLQLRDQA SLGSKVKPIS LADHCTQPGQ KCTVSGWGTV TSPRENFPDT LNCAEVKIFP 

       190        200        210        220        230        240 
QKKCEDAYPG QITDGMVCAG SSKGADTCQG DSGGPLVCDG ALQGITSWGS DPCGRSDKPG 

       250        260 
VYTNICRYLD WIKKIIGSKG 

« Hide

Isoform 2 [UniParc].

Checksum: 2972CED7B2706AF0
Show »

FASTA30532,966
Isoform 3 [UniParc].

Checksum: 2FD8164DF1641FFF
Show »

FASTA11912,719
Isoform 4 [UniParc].

Checksum: 905DA8F5F9C8A664
Show »

FASTA323,653

References

« Hide 'large scale' references
[1]"Sequence analysis and expression of human neuropsin cDNA and gene."
Yoshida S., Taniguchi M., Hirata A., Shiosaka S.
Gene 213:9-16(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
Tissue: Hippocampus.
[2]"Cloning of tumor-associated differentially expressed gene-14, a novel serine protease overexpressed by ovarian carcinoma."
Underwood L.J., Tanimoto H., Wang Y., Shigemasa K., Parmley T.H., O'Brien T.J.
Cancer Res. 59:4435-4439(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Ovary.
[3]"A novel form of human neuropsin, a brain-related serine protease, is generated by alternative splicing and is expressed preferentially in human adult brain."
Mitsui S., Tsuruoka N., Yamashiro K., Nakazato H., Yamaguchi N.
Eur. J. Biochem. 260:627-634(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain.
[4]"Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region."
Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K.
Gene 257:119-130(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[5]"The human KLK8 (neuropsin/ovasin) gene: identification of two novel splice variants and its prognostic value in ovarian cancer."
Magklara A., Scorilas A., Katsaros D., Massobrio M., Yousef G.M., Fracchioli S., Danese S., Diamandis E.P.
Clin. Cancer Res. 7:806-811(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 3 AND 4), TISSUE SPECIFICITY.
[6]"Molecular cloning and characterization of a novel serine protease, ovasin, a potential molecular marker for ovarian carcinomas."
Gan L., Gelinas R., Gown A.M., Moss P., Smith R., Wang K.
Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
[7]"Human kallikrein 8 and human kallikrein 9 are organized as a bicistronic operon."
Michael I.P., Diamandis E.P.
Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[8]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[9]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[11]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[12]"Recent origin of a hominoid-specific splice form of neuropsin, a gene involved in learning and memory."
Li Y., Qian Y.-P., Yu X.-J., Wang Y.-Q., Dong D.-G., Sun W., Ma R.-M., Su B.
Mol. Biol. Evol. 21:2111-2115(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
[13]"Expression of the kallikrein gene family in normal and Alzheimer's disease brain."
Shimizu-Okabe C., Yousef G.M., Diamandis E.P., Yoshida S., Shiosaka S., Fahnestock M.
NeuroReport 12:2747-2751(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[14]"Epidermal expression of serine protease, neuropsin (KLK8) in normal and pathological skin samples."
Kuwae K., Matsumoto-Miyai K., Yoshida S., Sadayama T., Yoshikawa K., Hosokawa K., Shiosaka S.
Mol. Pathol. 55:235-241(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[15]"Human kallikrein 8, a novel biomarker for ovarian carcinoma."
Kishi T., Grass L., Soosaipillai A., Scorilas A., Harbeck N., Schmalfeldt B., Dorn J., Mysliwiec M., Schmitt M., Diamandis E.P.
Cancer Res. 63:2771-2774(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: USE AS A MARKER FOR OVARIAN CANCER.
[16]"Biochemical characterization of human kallikrein 8 and its possible involvement in the degradation of extracellular matrix proteins."
Rajapakse S., Ogiwara K., Takano N., Moriyama A., Takahashi T.
FEBS Lett. 579:6879-6884(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES.
[17]"A human-specific mutation leads to the origin of a novel splice form of neuropsin (KLK8), a gene involved in learning and memory."
Lu Z.-X., Peng J., Su B.
Hum. Mutat. 28:978-984(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING (ISOFORM 2).
[18]"SerpinB6 is an inhibitor of kallikrein-8 in keratinocytes."
Scott F.L., Sun J., Whisstock J.C., Kato K., Bird P.I.
J. Biochem. 142:435-442(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[19]"SPINK9: a selective, skin-specific Kazal-type serine protease inhibitor."
Brattsand M., Stefansson K., Hubiche T., Nilsson S.K., Egelrud T.
J. Invest. Dermatol. 129:1656-1665(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH SPINK9.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB009849 mRNA. Translation: BAA28673.1.
AB012761 Genomic DNA. Translation: BAA28676.1.
AF055982 mRNA. Translation: AAD56050.1.
AB008390 mRNA. Translation: BAA82665.1.
AB008927 mRNA. Translation: BAA82666.1.
AB010780 Genomic DNA. Translation: BAA88684.1.
AF243527 Genomic DNA. Translation: AAG33361.1.
AF251125 Genomic DNA. Translation: AAF79144.1.
AF251125 Genomic DNA. Translation: AAF79145.1.
AF095742 mRNA. Translation: AAD25979.1.
AF095743 Genomic DNA. Translation: AAD29574.1.
DQ267420 mRNA. Translation: ABB83339.1.
AY359036 mRNA. Translation: AAQ89395.1.
AC011473 Genomic DNA. Translation: AAG23254.1.
AC011483 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW71962.1.
BC040887 mRNA. Translation: AAH40887.1.
AY563055 Genomic DNA. Translation: AAT76913.1.
AY563055 Genomic DNA. Translation: AAT76914.1.
AY563056 Genomic DNA. Translation: AAT76915.1.
AY563056 Genomic DNA. Translation: AAT76916.1.
AY563057 Genomic DNA. Translation: AAT76917.1.
AY563057 Genomic DNA. Translation: AAT76918.1.
AY563058 Genomic DNA. Translation: AAT76919.1.
AY563058 Genomic DNA. Translation: AAT76920.1.
AY563059 Genomic DNA. Translation: AAT76921.1.
AY563059 Genomic DNA. Translation: AAT76922.1.
AY563060 Genomic DNA. Translation: AAT76923.1.
AY563060 Genomic DNA. Translation: AAT76924.1.
AY563061 Genomic DNA. Translation: AAT76925.1.
AY563061 Genomic DNA. Translation: AAT76926.1.
AY563062 Genomic DNA. Translation: AAT76927.1.
AY563062 Genomic DNA. Translation: AAT76928.1.
AY563063 Genomic DNA. Translation: AAT76929.1.
AY563063 Genomic DNA. Translation: AAT76930.1.
AY563064 Genomic DNA. Translation: AAT76931.1.
AY563064 Genomic DNA. Translation: AAT76932.1.
AY563065 Genomic DNA. Translation: AAT76933.1.
AY563065 Genomic DNA. Translation: AAT76934.1.
AY563066 Genomic DNA. Translation: AAT76935.1.
AY563066 Genomic DNA. Translation: AAT76936.1.
AY563067 Genomic DNA. Translation: AAT76937.1.
AY563067 Genomic DNA. Translation: AAT76938.1.
CCDSCCDS12813.1. [O60259-1]
CCDS12814.1. [O60259-3]
CCDS12815.1. [O60259-4]
CCDS42600.1. [O60259-2]
RefSeqNP_001268360.1. NM_001281431.1.
NP_009127.1. NM_007196.3. [O60259-1]
NP_653088.1. NM_144505.2. [O60259-2]
NP_653089.1. NM_144506.2. [O60259-3]
NP_653090.1. NM_144507.2. [O60259-4]
UniGeneHs.104570.

3D structure databases

ProteinModelPortalO60259.
SMRO60259. Positions 33-256.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116371. 1 interaction.
IntActO60259. 2 interactions.

Chemistry

BindingDBO60259.
ChEMBLCHEMBL4812.

Protein family/group databases

MEROPSS01.244.

PTM databases

PhosphoSiteO60259.

Proteomic databases

PaxDbO60259.
PRIDEO60259.

Protocols and materials databases

DNASU11202.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000291726; ENSP00000291726; ENSG00000129455. [O60259-1]
ENST00000320838; ENSP00000325072; ENSG00000129455. [O60259-4]
ENST00000347619; ENSP00000341555; ENSG00000129455. [O60259-3]
ENST00000391806; ENSP00000375682; ENSG00000129455. [O60259-2]
ENST00000593490; ENSP00000469278; ENSG00000129455. [O60259-4]
ENST00000600767; ENSP00000472016; ENSG00000129455. [O60259-1]
GeneID11202.
KEGGhsa:11202.
UCSCuc002puq.1. human. [O60259-2]
uc002pur.1. human. [O60259-1]
uc002pus.1. human. [O60259-3]
uc002put.1. human. [O60259-4]

Organism-specific databases

CTD11202.
GeneCardsGC19M051499.
HGNCHGNC:6369. KLK8.
HPACAB019393.
MIM605644. gene.
neXtProtNX_O60259.
PharmGKBPA30158.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5640.
HOVERGENHBG013304.
KOK08650.
OMATKLYAEN.
OrthoDBEOG75B84T.
PhylomeDBO60259.
TreeFamTF331065.

Enzyme and pathway databases

BRENDA3.4.21.118. 2681.

Gene expression databases

ArrayExpressO60259.
BgeeO60259.
GenevestigatorO60259.

Family and domain databases

InterProIPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSPR00722. CHYMOTRYPSIN.
SMARTSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMSSF50494. SSF50494. 1 hit.
PROSITEPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiKLK8.
GenomeRNAi11202.
NextBio42641.
PROO60259.
SOURCESearch...

Entry information

Entry nameKLK8_HUMAN
AccessionPrimary (citable) accession number: O60259
Secondary accession number(s): Q5V9X1 expand/collapse secondary AC list , Q5V9X2, Q8IW69, Q9HCB3, Q9NR68, Q9NR69, Q9UIL9, Q9UQ47
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: August 1, 1998
Last modified: July 9, 2014
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM