Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O60225 (SSX5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein SSX5
Gene names
Name:SSX5
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length188 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Could act as a modulator of transcription.

Sequence similarities

Belongs to the SSX family.

Contains 1 KRAB-related domain.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Coding sequence diversityAlternative splicing
Polymorphism
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processregulation of transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: InterPro

   Molecular_functionnucleic acid binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O60225-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O60225-2)

The sequence of this isoform differs from the canonical sequence as follows:
     23-23: K → KHPWRQVCDRGIHLVNLSPFWKVGREPASSIKALLCGRGEAR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 188188Protein SSX5
PRO_0000181832

Regions

Domain20 – 8364KRAB-related

Natural variations

Alternative sequence231K → KHPWRQVCDRGIHLVNLSPF WKVGREPASSIKALLCGRGE AR in isoform 2.
VSP_006274
Natural variant191E → Q. Ref.1 Ref.3
Corresponds to variant rs4824675 [ dbSNP | Ensembl ].
VAR_027805

Experimental info

Sequence conflict1841Q → P in AAC05821. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 3, 2006. Version 3.
Checksum: DBFA61D8B1295A27

FASTA18821,660
        10         20         30         40         50         60 
MNGDDAFVRR PRVGSQIPEK MQKAFDDIAK YFSEKEWEKM KASEKIIYVY MKRKYEAMTK 

        70         80         90        100        110        120 
LGFKATLPPF MRNKRVADFQ GNDFDNDPNR GNQVEHPQMT FGRLQGIFPK ITPEKPAEEG 

       130        140        150        160        170        180 
NDSKGVPEAS GPQNNGKQLR PSGKLNTSEK VNKTSGPKRG KHAWTHRVRE RKQLVIYEEI 


SDPQEDDE 

« Hide

Isoform 2 [UniParc].

Checksum: F2EC22A6B5C02F08
Show »

FASTA22926,284

References

« Hide 'large scale' references
[1]"SSX: a multigene family with several members transcribed in normal testis and human cancer."
Gure A.O., Tuereci O., Sahin U., Tsang S., Scanlan M.J., Jager E., Knuth A., Pfreundschuh M., Old L.J., Chen Y.-T.
Int. J. Cancer 72:965-971(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLN-19.
[2]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-19.
Tissue: Skin.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U90842 mRNA. Translation: AAC05821.1.
AL683817, AL356464 Genomic DNA. Translation: CAI41133.1.
AL683817, AL356464 Genomic DNA. Translation: CAI41134.1.
AL356464, AL683817 Genomic DNA. Translation: CAI40523.1.
AL356464, AL683817 Genomic DNA. Translation: CAI40524.1.
BC016640 mRNA. Translation: AAH16640.1.
RefSeqNP_066295.3. NM_021015.3.
NP_783729.1. NM_175723.1.
UniGeneHs.166198.

3D structure databases

ProteinModelPortalO60225.
SMRO60225. Positions 19-70.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid112636. 3 interactions.
STRING9606.ENSP00000312415.

PTM databases

PhosphoSiteO60225.

Proteomic databases

PaxDbO60225.
PRIDEO60225.

Protocols and materials databases

DNASU6758.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000311798; ENSP00000312415; ENSG00000165583. [O60225-2]
ENST00000347757; ENSP00000290558; ENSG00000165583. [O60225-1]
ENST00000376923; ENSP00000366122; ENSG00000165583. [O60225-1]
ENST00000594016; ENSP00000469469; ENSG00000268256. [O60225-2]
ENST00000594778; ENSP00000473180; ENSG00000268256. [O60225-1]
ENST00000596327; ENSP00000472588; ENSG00000268256. [O60225-1]
GeneID6758.
KEGGhsa:6758.
UCSCuc004diz.1. human. [O60225-2]
uc004dja.1. human. [O60225-1]

Organism-specific databases

CTD6758.
GeneCardsGC0XM048045.
HGNCHGNC:11339. SSX5.
MIM300327. gene.
neXtProtNX_O60225.
PharmGKBPA36163.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG147456.
HOGENOMHOG000231461.
HOVERGENHBG002056.
OMAKRNYDIM.
PhylomeDBO60225.
TreeFamTF338517.

Gene expression databases

ArrayExpressO60225.
BgeeO60225.
CleanExHS_SSX5.
GenevestigatorO60225.

Family and domain databases

InterProIPR001909. Krueppel-associated_box.
IPR003655. Krueppel-associated_box-rel.
IPR028804. SSX.
IPR019041. SSXRD_motif.
[Graphical view]
PANTHERPTHR14112. PTHR14112. 1 hit.
PfamPF09514. SSXRD. 1 hit.
[Graphical view]
SMARTSM00349. KRAB. 1 hit.
[Graphical view]
SUPFAMSSF109640. SSF109640. 1 hit.
PROSITEPS50806. KRAB_RELATED. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiSSX5.
GenomeRNAi6758.
NextBio26374.
PROO60225.
SOURCESearch...

Entry information

Entry nameSSX5_HUMAN
AccessionPrimary (citable) accession number: O60225
Secondary accession number(s): Q5JQ59, Q5JQ60, Q96AW3
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: October 3, 2006
Last modified: April 16, 2014
This is version 115 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM