Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O60225

- SSX5_HUMAN

UniProt

O60225 - SSX5_HUMAN

Protein

Protein SSX5

Gene

SSX5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
  1. Functioni

    Could act as a modulator of transcription.

    GO - Molecular functioni

    1. nucleic acid binding Source: InterPro

    GO - Biological processi

    1. regulation of transcription, DNA-templated Source: UniProtKB-KW
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein SSX5
    Gene namesi
    Name:SSX5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:11339. SSX5.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: InterPro

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36163.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 188188Protein SSX5PRO_0000181832Add
    BLAST

    Proteomic databases

    PaxDbiO60225.
    PRIDEiO60225.

    PTM databases

    PhosphoSiteiO60225.

    Expressioni

    Gene expression databases

    ArrayExpressiO60225.
    BgeeiO60225.
    CleanExiHS_SSX5.
    GenevestigatoriO60225.

    Interactioni

    Protein-protein interaction databases

    BioGridi112636. 3 interactions.
    STRINGi9606.ENSP00000312415.

    Structurei

    3D structure databases

    ProteinModelPortaliO60225.
    SMRiO60225. Positions 19-70.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini20 – 8364KRAB-relatedPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the SSX family.Curated
    Contains 1 KRAB-related domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG147456.
    HOGENOMiHOG000231461.
    HOVERGENiHBG002056.
    OMAiKRNYDIM.
    PhylomeDBiO60225.
    TreeFamiTF338517.

    Family and domain databases

    InterProiIPR001909. Krueppel-associated_box.
    IPR003655. Krueppel-associated_box-rel.
    IPR028804. SSX.
    IPR019041. SSXRD_motif.
    [Graphical view]
    PANTHERiPTHR14112. PTHR14112. 1 hit.
    PfamiPF09514. SSXRD. 1 hit.
    [Graphical view]
    SMARTiSM00349. KRAB. 1 hit.
    [Graphical view]
    SUPFAMiSSF109640. SSF109640. 1 hit.
    PROSITEiPS50806. KRAB_RELATED. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O60225-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNGDDAFVRR PRVGSQIPEK MQKAFDDIAK YFSEKEWEKM KASEKIIYVY    50
    MKRKYEAMTK LGFKATLPPF MRNKRVADFQ GNDFDNDPNR GNQVEHPQMT 100
    FGRLQGIFPK ITPEKPAEEG NDSKGVPEAS GPQNNGKQLR PSGKLNTSEK 150
    VNKTSGPKRG KHAWTHRVRE RKQLVIYEEI SDPQEDDE 188
    Length:188
    Mass (Da):21,660
    Last modified:October 3, 2006 - v3
    Checksum:iDBFA61D8B1295A27
    GO
    Isoform 2 (identifier: O60225-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         23-23: K → KHPWRQVCDRGIHLVNLSPFWKVGREPASSIKALLCGRGEAR

    Note: No experimental confirmation available.

    Show »
    Length:229
    Mass (Da):26,284
    Checksum:iF2EC22A6B5C02F08
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti184 – 1841Q → P in AAC05821. (PubMed:9378559)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti19 – 191E → Q.2 Publications
    Corresponds to variant rs4824675 [ dbSNP | Ensembl ].
    VAR_027805

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei23 – 231K → KHPWRQVCDRGIHLVNLSPF WKVGREPASSIKALLCGRGE AR in isoform 2. 1 PublicationVSP_006274

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U90842 mRNA. Translation: AAC05821.1.
    AL683817, AL356464 Genomic DNA. Translation: CAI41133.1.
    AL683817, AL356464 Genomic DNA. Translation: CAI41134.1.
    AL356464, AL683817 Genomic DNA. Translation: CAI40523.1.
    AL356464, AL683817 Genomic DNA. Translation: CAI40524.1.
    BC016640 mRNA. Translation: AAH16640.1.
    CCDSiCCDS14288.1. [O60225-2]
    CCDS14289.1. [O60225-1]
    RefSeqiNP_066295.3. NM_021015.3. [O60225-2]
    NP_783729.1. NM_175723.1. [O60225-1]
    UniGeneiHs.166198.

    Genome annotation databases

    EnsembliENST00000311798; ENSP00000312415; ENSG00000165583. [O60225-2]
    ENST00000347757; ENSP00000290558; ENSG00000165583. [O60225-1]
    ENST00000376923; ENSP00000366122; ENSG00000165583. [O60225-1]
    GeneIDi6758.
    KEGGihsa:6758.
    UCSCiuc004diz.1. human. [O60225-2]
    uc004dja.1. human. [O60225-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U90842 mRNA. Translation: AAC05821.1 .
    AL683817 , AL356464 Genomic DNA. Translation: CAI41133.1 .
    AL683817 , AL356464 Genomic DNA. Translation: CAI41134.1 .
    AL356464 , AL683817 Genomic DNA. Translation: CAI40523.1 .
    AL356464 , AL683817 Genomic DNA. Translation: CAI40524.1 .
    BC016640 mRNA. Translation: AAH16640.1 .
    CCDSi CCDS14288.1. [O60225-2 ]
    CCDS14289.1. [O60225-1 ]
    RefSeqi NP_066295.3. NM_021015.3. [O60225-2 ]
    NP_783729.1. NM_175723.1. [O60225-1 ]
    UniGenei Hs.166198.

    3D structure databases

    ProteinModelPortali O60225.
    SMRi O60225. Positions 19-70.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112636. 3 interactions.
    STRINGi 9606.ENSP00000312415.

    PTM databases

    PhosphoSitei O60225.

    Proteomic databases

    PaxDbi O60225.
    PRIDEi O60225.

    Protocols and materials databases

    DNASUi 6758.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000311798 ; ENSP00000312415 ; ENSG00000165583 . [O60225-2 ]
    ENST00000347757 ; ENSP00000290558 ; ENSG00000165583 . [O60225-1 ]
    ENST00000376923 ; ENSP00000366122 ; ENSG00000165583 . [O60225-1 ]
    GeneIDi 6758.
    KEGGi hsa:6758.
    UCSCi uc004diz.1. human. [O60225-2 ]
    uc004dja.1. human. [O60225-1 ]

    Organism-specific databases

    CTDi 6758.
    GeneCardsi GC0XM048045.
    HGNCi HGNC:11339. SSX5.
    MIMi 300327. gene.
    neXtProti NX_O60225.
    PharmGKBi PA36163.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG147456.
    HOGENOMi HOG000231461.
    HOVERGENi HBG002056.
    OMAi KRNYDIM.
    PhylomeDBi O60225.
    TreeFami TF338517.

    Miscellaneous databases

    GeneWikii SSX5.
    GenomeRNAii 6758.
    NextBioi 26374.
    PROi O60225.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O60225.
    Bgeei O60225.
    CleanExi HS_SSX5.
    Genevestigatori O60225.

    Family and domain databases

    InterProi IPR001909. Krueppel-associated_box.
    IPR003655. Krueppel-associated_box-rel.
    IPR028804. SSX.
    IPR019041. SSXRD_motif.
    [Graphical view ]
    PANTHERi PTHR14112. PTHR14112. 1 hit.
    Pfami PF09514. SSXRD. 1 hit.
    [Graphical view ]
    SMARTi SM00349. KRAB. 1 hit.
    [Graphical view ]
    SUPFAMi SSF109640. SSF109640. 1 hit.
    PROSITEi PS50806. KRAB_RELATED. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "SSX: a multigene family with several members transcribed in normal testis and human cancer."
      Gure A.O., Tuereci O., Sahin U., Tsang S., Scanlan M.J., Jager E., Knuth A., Pfreundschuh M., Old L.J., Chen Y.-T.
      Int. J. Cancer 72:965-971(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLN-19.
    2. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-19.
      Tissue: Skin.

    Entry informationi

    Entry nameiSSX5_HUMAN
    AccessioniPrimary (citable) accession number: O60225
    Secondary accession number(s): Q5JQ59, Q5JQ60, Q96AW3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: October 3, 2006
    Last modified: October 1, 2014
    This is version 118 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3