O60225 (SSX5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein SSX5 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 188 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Could act as a modulator of transcription. |
| Sequence similarities | Belongs to the SSX family. Contains 1 KRAB-related domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleus Inferred from electronic annotation. Source: InterPro |
| Molecular_function | nucleic acid binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O60225-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O60225-2) The sequence of this isoform differs from the canonical sequence as follows: 23-23: K → KHPWRQVCDRGIHLVNLSPFWKVGREPASSIKALLCGRGEAR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 188 | 188 | Protein SSX5 | PRO_0000181832 | |||||
Regions | |||||||||
| Domain | 20 – 83 | 64 | KRAB-related | ||||||
Natural variations | |||||||||
| Alternative sequence | 23 | 1 | K → KHPWRQVCDRGIHLVNLSPF WKVGREPASSIKALLCGRGE AR in isoform 2. | VSP_006274 | |||||
| Natural variant | 19 | 1 | E → Q. Ref.1 Ref.3 Corresponds to variant rs4824675 [ dbSNP | Ensembl ]. | VAR_027805 | |||||
Experimental info | |||||||||
| Sequence conflict | 184 | 1 | Q → P in AAC05821. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "SSX: a multigene family with several members transcribed in normal testis and human cancer." Gure A.O., Tuereci O., Sahin U., Tsang S., Scanlan M.J., Jager E., Knuth A., Pfreundschuh M., Old L.J., Chen Y.-T. Int. J. Cancer 72:965-971(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLN-19. |
| [2] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-19. Tissue: Skin. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U90842 mRNA. Translation: AAC05821.1. AL683817, AL356464 Genomic DNA. Translation: CAI41133.1. AL683817, AL356464 Genomic DNA. Translation: CAI41134.1. AL356464, AL683817 Genomic DNA. Translation: CAI40523.1. AL356464, AL683817 Genomic DNA. Translation: CAI40524.1. BC016640 mRNA. Translation: AAH16640.1. |
| IPI | IPI00028378. IPI00220969. |
| RefSeq | NP_066295.3. NM_021015.3. NP_783729.1. NM_175723.1. |
| UniGene | Hs.166198. |
3D structure databases | |
| ProteinModelPortal | O60225. |
| SMR | O60225. Positions 19-70. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000312415. |
PTM databases | |
| PhosphoSite | O60225. |
Proteomic databases | |
| PaxDb | O60225. |
| PRIDE | O60225. |
Protocols and materials databases | |
| DNASU | 6758. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000311798; ENSP00000312415; ENSG00000165583. ENST00000347757; ENSP00000290558; ENSG00000165583. ENST00000376923; ENSP00000366122; ENSG00000165583. ENST00000594016; ENSP00000469469; ENSG00000268256. ENST00000594778; ENSP00000473180; ENSG00000268256. ENST00000596327; ENSP00000472588; ENSG00000268256. |
| GeneID | 6758. |
| KEGG | hsa:6758. |
| UCSC | uc004diz.1. human. uc004dja.1. human. |
Organism-specific databases | |
| CTD | 6758. |
| GeneCards | GC0XM048045. |
| HGNC | HGNC:11339. SSX5. |
| MIM | 300327. gene. |
| neXtProt | NX_O60225. |
| PharmGKB | PA36163. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG147456. |
| HOGENOM | HOG000231461. |
| HOVERGEN | HBG002056. |
| OMA | EKEWEKM. |
Gene expression databases | |
| ArrayExpress | O60225. |
| Bgee | O60225. |
| CleanEx | HS_SSX5. |
| Genevestigator | O60225. |
| GermOnline | ENSG00000165583. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001909. Krueppel-associated_box. IPR003655. Krueppel-associated_box-rel. IPR019041. SSXRD_motif. [Graphical view] |
| Pfam | PF09514. SSXRD. 1 hit. [Graphical view] |
| SMART | SM00349. KRAB. 1 hit. [Graphical view] |
| SUPFAM | SSF109640. Krueppel-associated_box. 1 hit. |
| PROSITE | PS50806. KRAB_RELATED. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 6758. |
| NextBio | 26374. |
| SOURCE | Search... |
Entry information
| Entry name | SSX5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O60225 Secondary accession number(s): Q5JQ59, Q5JQ60, Q96AW3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
