Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O60225

- SSX5_HUMAN

UniProt

O60225 - SSX5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein SSX5

Gene

SSX5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Could act as a modulator of transcription.

GO - Molecular functioni

  1. nucleic acid binding Source: InterPro

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: UniProtKB-KW
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Protein SSX5
Gene namesi
Name:SSX5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:11339. SSX5.

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: InterPro
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36163.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 188188Protein SSX5PRO_0000181832Add
BLAST

Proteomic databases

PaxDbiO60225.
PRIDEiO60225.

PTM databases

PhosphoSiteiO60225.

Expressioni

Gene expression databases

BgeeiO60225.
CleanExiHS_SSX5.
ExpressionAtlasiO60225. baseline.
GenevestigatoriO60225.

Interactioni

Protein-protein interaction databases

BioGridi112636. 3 interactions.
STRINGi9606.ENSP00000312415.

Structurei

3D structure databases

ProteinModelPortaliO60225.
SMRiO60225. Positions 19-70.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini20 – 8364KRAB-relatedPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the SSX family.Curated
Contains 1 KRAB-related domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG147456.
GeneTreeiENSGT00390000012484.
HOGENOMiHOG000231461.
HOVERGENiHBG002056.
InParanoidiO60225.
OMAiKRNYDIM.
PhylomeDBiO60225.
TreeFamiTF338517.

Family and domain databases

InterProiIPR001909. Krueppel-associated_box.
IPR003655. Krueppel-associated_box-rel.
IPR028804. SSX.
IPR019041. SSXRD_motif.
[Graphical view]
PANTHERiPTHR14112. PTHR14112. 1 hit.
PfamiPF09514. SSXRD. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50806. KRAB_RELATED. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O60225-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNGDDAFVRR PRVGSQIPEK MQKAFDDIAK YFSEKEWEKM KASEKIIYVY
60 70 80 90 100
MKRKYEAMTK LGFKATLPPF MRNKRVADFQ GNDFDNDPNR GNQVEHPQMT
110 120 130 140 150
FGRLQGIFPK ITPEKPAEEG NDSKGVPEAS GPQNNGKQLR PSGKLNTSEK
160 170 180
VNKTSGPKRG KHAWTHRVRE RKQLVIYEEI SDPQEDDE
Length:188
Mass (Da):21,660
Last modified:October 3, 2006 - v3
Checksum:iDBFA61D8B1295A27
GO
Isoform 2 (identifier: O60225-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     23-23: K → KHPWRQVCDRGIHLVNLSPFWKVGREPASSIKALLCGRGEAR

Note: No experimental confirmation available.

Show »
Length:229
Mass (Da):26,284
Checksum:iF2EC22A6B5C02F08
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti184 – 1841Q → P in AAC05821. (PubMed:9378559)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti19 – 191E → Q.2 Publications
Corresponds to variant rs4824675 [ dbSNP | Ensembl ].
VAR_027805

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei23 – 231K → KHPWRQVCDRGIHLVNLSPF WKVGREPASSIKALLCGRGE AR in isoform 2. 1 PublicationVSP_006274

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U90842 mRNA. Translation: AAC05821.1.
AL683817, AL356464 Genomic DNA. Translation: CAI41133.1.
AL683817, AL356464 Genomic DNA. Translation: CAI41134.1.
AL356464, AL683817 Genomic DNA. Translation: CAI40523.1.
AL356464, AL683817 Genomic DNA. Translation: CAI40524.1.
BC016640 mRNA. Translation: AAH16640.1.
CCDSiCCDS14288.1. [O60225-2]
CCDS14289.1. [O60225-1]
RefSeqiNP_066295.3. NM_021015.3. [O60225-2]
NP_783729.1. NM_175723.1. [O60225-1]
UniGeneiHs.166198.

Genome annotation databases

EnsembliENST00000311798; ENSP00000312415; ENSG00000165583. [O60225-2]
ENST00000347757; ENSP00000290558; ENSG00000165583. [O60225-1]
ENST00000376923; ENSP00000366122; ENSG00000165583. [O60225-1]
GeneIDi6758.
KEGGihsa:6758.
UCSCiuc004diz.1. human. [O60225-2]
uc004dja.1. human. [O60225-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U90842 mRNA. Translation: AAC05821.1 .
AL683817 , AL356464 Genomic DNA. Translation: CAI41133.1 .
AL683817 , AL356464 Genomic DNA. Translation: CAI41134.1 .
AL356464 , AL683817 Genomic DNA. Translation: CAI40523.1 .
AL356464 , AL683817 Genomic DNA. Translation: CAI40524.1 .
BC016640 mRNA. Translation: AAH16640.1 .
CCDSi CCDS14288.1. [O60225-2 ]
CCDS14289.1. [O60225-1 ]
RefSeqi NP_066295.3. NM_021015.3. [O60225-2 ]
NP_783729.1. NM_175723.1. [O60225-1 ]
UniGenei Hs.166198.

3D structure databases

ProteinModelPortali O60225.
SMRi O60225. Positions 19-70.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112636. 3 interactions.
STRINGi 9606.ENSP00000312415.

PTM databases

PhosphoSitei O60225.

Proteomic databases

PaxDbi O60225.
PRIDEi O60225.

Protocols and materials databases

DNASUi 6758.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000311798 ; ENSP00000312415 ; ENSG00000165583 . [O60225-2 ]
ENST00000347757 ; ENSP00000290558 ; ENSG00000165583 . [O60225-1 ]
ENST00000376923 ; ENSP00000366122 ; ENSG00000165583 . [O60225-1 ]
GeneIDi 6758.
KEGGi hsa:6758.
UCSCi uc004diz.1. human. [O60225-2 ]
uc004dja.1. human. [O60225-1 ]

Organism-specific databases

CTDi 6758.
GeneCardsi GC0XM048045.
HGNCi HGNC:11339. SSX5.
MIMi 300327. gene.
neXtProti NX_O60225.
PharmGKBi PA36163.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG147456.
GeneTreei ENSGT00390000012484.
HOGENOMi HOG000231461.
HOVERGENi HBG002056.
InParanoidi O60225.
OMAi KRNYDIM.
PhylomeDBi O60225.
TreeFami TF338517.

Miscellaneous databases

GeneWikii SSX5.
GenomeRNAii 6758.
NextBioi 26374.
PROi O60225.
SOURCEi Search...

Gene expression databases

Bgeei O60225.
CleanExi HS_SSX5.
ExpressionAtlasi O60225. baseline.
Genevestigatori O60225.

Family and domain databases

InterProi IPR001909. Krueppel-associated_box.
IPR003655. Krueppel-associated_box-rel.
IPR028804. SSX.
IPR019041. SSXRD_motif.
[Graphical view ]
PANTHERi PTHR14112. PTHR14112. 1 hit.
Pfami PF09514. SSXRD. 1 hit.
[Graphical view ]
SMARTi SM00349. KRAB. 1 hit.
[Graphical view ]
SUPFAMi SSF109640. SSF109640. 1 hit.
PROSITEi PS50806. KRAB_RELATED. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "SSX: a multigene family with several members transcribed in normal testis and human cancer."
    Gure A.O., Tuereci O., Sahin U., Tsang S., Scanlan M.J., Jager E., Knuth A., Pfreundschuh M., Old L.J., Chen Y.-T.
    Int. J. Cancer 72:965-971(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLN-19.
  2. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-19.
    Tissue: Skin.

Entry informationi

Entry nameiSSX5_HUMAN
AccessioniPrimary (citable) accession number: O60225
Secondary accession number(s): Q5JQ59, Q5JQ60, Q96AW3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: October 3, 2006
Last modified: October 29, 2014
This is version 119 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3