Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein SSX5

Gene

SSX5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Could act as a modulator of transcription.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Protein SSX5
Gene namesi
Name:SSX5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:11339. SSX5.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36163.

Polymorphism and mutation databases

BioMutaiSSX5.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 188188Protein SSX5PRO_0000181832Add
BLAST

Proteomic databases

PaxDbiO60225.
PRIDEiO60225.

PTM databases

PhosphoSiteiO60225.

Expressioni

Gene expression databases

BgeeiO60225.
CleanExiHS_SSX5.
ExpressionAtlasiO60225. baseline.
GenevisibleiO60225. HS.

Organism-specific databases

HPAiHPA045683.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
AGTRAPQ6RW133EBI-10186198,EBI-741181

Protein-protein interaction databases

BioGridi112636. 4 interactions.
IntActiO60225. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliO60225.
SMRiO60225. Positions 19-70.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini20 – 8364KRAB-relatedPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the SSX family.Curated
Contains 1 KRAB-related domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG147456.
GeneTreeiENSGT00390000012484.
HOGENOMiHOG000231461.
HOVERGENiHBG002056.
InParanoidiO60225.
OMAiFVRRPRV.
PhylomeDBiO60225.
TreeFamiTF338517.

Family and domain databases

InterProiIPR001909. Krueppel-associated_box.
IPR003655. Krueppel-associated_box-rel.
IPR028804. SSX.
IPR019041. SSXRD_motif.
[Graphical view]
PANTHERiPTHR14112. PTHR14112. 1 hit.
PfamiPF09514. SSXRD. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50806. KRAB_RELATED. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O60225-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNGDDAFVRR PRVGSQIPEK MQKAFDDIAK YFSEKEWEKM KASEKIIYVY
60 70 80 90 100
MKRKYEAMTK LGFKATLPPF MRNKRVADFQ GNDFDNDPNR GNQVEHPQMT
110 120 130 140 150
FGRLQGIFPK ITPEKPAEEG NDSKGVPEAS GPQNNGKQLR PSGKLNTSEK
160 170 180
VNKTSGPKRG KHAWTHRVRE RKQLVIYEEI SDPQEDDE
Length:188
Mass (Da):21,660
Last modified:October 3, 2006 - v3
Checksum:iDBFA61D8B1295A27
GO
Isoform 2 (identifier: O60225-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     23-23: K → KHPWRQVCDRGIHLVNLSPFWKVGREPASSIKALLCGRGEAR

Note: No experimental confirmation available.
Show »
Length:229
Mass (Da):26,284
Checksum:iF2EC22A6B5C02F08
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti184 – 1841Q → P in AAC05821 (PubMed:9378559).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti19 – 191E → Q.2 Publications
Corresponds to variant rs4824675 [ dbSNP | Ensembl ].
VAR_027805

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei23 – 231K → KHPWRQVCDRGIHLVNLSPF WKVGREPASSIKALLCGRGE AR in isoform 2. 1 PublicationVSP_006274

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U90842 mRNA. Translation: AAC05821.1.
AL683817, AL356464 Genomic DNA. Translation: CAI41133.1.
AL683817, AL356464 Genomic DNA. Translation: CAI41134.1.
AL356464, AL683817 Genomic DNA. Translation: CAI40523.1.
AL356464, AL683817 Genomic DNA. Translation: CAI40524.1.
BC016640 mRNA. Translation: AAH16640.1.
CCDSiCCDS14288.1. [O60225-2]
CCDS14289.1. [O60225-1]
RefSeqiNP_066295.3. NM_021015.3. [O60225-2]
NP_783729.1. NM_175723.1. [O60225-1]
UniGeneiHs.166198.

Genome annotation databases

EnsembliENST00000311798; ENSP00000312415; ENSG00000165583. [O60225-2]
ENST00000347757; ENSP00000290558; ENSG00000165583. [O60225-1]
ENST00000376923; ENSP00000366122; ENSG00000165583. [O60225-1]
GeneIDi6758.
KEGGihsa:6758.
UCSCiuc004diz.1. human. [O60225-2]
uc004dja.1. human. [O60225-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U90842 mRNA. Translation: AAC05821.1.
AL683817, AL356464 Genomic DNA. Translation: CAI41133.1.
AL683817, AL356464 Genomic DNA. Translation: CAI41134.1.
AL356464, AL683817 Genomic DNA. Translation: CAI40523.1.
AL356464, AL683817 Genomic DNA. Translation: CAI40524.1.
BC016640 mRNA. Translation: AAH16640.1.
CCDSiCCDS14288.1. [O60225-2]
CCDS14289.1. [O60225-1]
RefSeqiNP_066295.3. NM_021015.3. [O60225-2]
NP_783729.1. NM_175723.1. [O60225-1]
UniGeneiHs.166198.

3D structure databases

ProteinModelPortaliO60225.
SMRiO60225. Positions 19-70.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112636. 4 interactions.
IntActiO60225. 1 interaction.

PTM databases

PhosphoSiteiO60225.

Polymorphism and mutation databases

BioMutaiSSX5.

Proteomic databases

PaxDbiO60225.
PRIDEiO60225.

Protocols and materials databases

DNASUi6758.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311798; ENSP00000312415; ENSG00000165583. [O60225-2]
ENST00000347757; ENSP00000290558; ENSG00000165583. [O60225-1]
ENST00000376923; ENSP00000366122; ENSG00000165583. [O60225-1]
GeneIDi6758.
KEGGihsa:6758.
UCSCiuc004diz.1. human. [O60225-2]
uc004dja.1. human. [O60225-1]

Organism-specific databases

CTDi6758.
GeneCardsiGC0XM048045.
HGNCiHGNC:11339. SSX5.
HPAiHPA045683.
MIMi300327. gene.
neXtProtiNX_O60225.
PharmGKBiPA36163.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG147456.
GeneTreeiENSGT00390000012484.
HOGENOMiHOG000231461.
HOVERGENiHBG002056.
InParanoidiO60225.
OMAiFVRRPRV.
PhylomeDBiO60225.
TreeFamiTF338517.

Miscellaneous databases

GeneWikiiSSX5.
GenomeRNAii6758.
NextBioi26374.
PROiO60225.
SOURCEiSearch...

Gene expression databases

BgeeiO60225.
CleanExiHS_SSX5.
ExpressionAtlasiO60225. baseline.
GenevisibleiO60225. HS.

Family and domain databases

InterProiIPR001909. Krueppel-associated_box.
IPR003655. Krueppel-associated_box-rel.
IPR028804. SSX.
IPR019041. SSXRD_motif.
[Graphical view]
PANTHERiPTHR14112. PTHR14112. 1 hit.
PfamiPF09514. SSXRD. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50806. KRAB_RELATED. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "SSX: a multigene family with several members transcribed in normal testis and human cancer."
    Gure A.O., Tuereci O., Sahin U., Tsang S., Scanlan M.J., Jager E., Knuth A., Pfreundschuh M., Old L.J., Chen Y.-T.
    Int. J. Cancer 72:965-971(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLN-19.
  2. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-19.
    Tissue: Skin.

Entry informationi

Entry nameiSSX5_HUMAN
AccessioniPrimary (citable) accession number: O60225
Secondary accession number(s): Q5JQ59, Q5JQ60, Q96AW3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: October 3, 2006
Last modified: June 24, 2015
This is version 124 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.