O55203 (LDB2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LIM domain-binding protein 2 Short name=LDB-2 Alternative name(s): Carboxyl-terminal LIM domain-binding protein 1 Short name=CLIM-1 LIM domain-binding factor CLIM1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 373 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. |
| Subunit structure | |
| Subcellular location | Nucleus Probable. |
| Post-translational modification | Ubiquitinated by RLIM/RNF12, leading to its degradation by the proteasome. Ref.5 |
| Sequence similarities | Belongs to the LDB family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O55203-1) Also known as: CLIM-1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O55203-2) Also known as: CLIM-1b; The sequence of this isoform differs from the canonical sequence as follows: 298-331: DVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA → GLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH 332-373: Missing. | ||||||
| Note: Lacks LIM-binding domain. | ||||||
| Isoform 3 (identifier: O55203-3) The sequence of this isoform differs from the canonical sequence as follows: 296-297: Missing. 298-331: DVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA → GLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH 332-373: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 373 | 373 | LIM domain-binding protein 2 | PRO_0000084388 | |||||
Regions | |||||||||
| Region | 298 – 336 | 39 | LIM-binding domain (LID) By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 296 – 297 | 2 | Missing in isoform 3. | VSP_027829 | |||||
| Alternative sequence | 298 – 331 | 34 | DVMVV…QYDAA → GLGAIPNCSLNPGRDGDLCH STAVTPSGQFKEKH in isoform 2 and isoform 3. | VSP_014369 | |||||
| Alternative sequence | 332 – 373 | 42 | Missing in isoform 2 and isoform 3. | VSP_014370 | |||||
Experimental info | |||||||||
| Sequence conflict | 272 | 1 | A → G in AAB96884. Ref.1 | ||||||
| Sequence conflict | 272 | 1 | A → G in AAB96886. Ref.1 | ||||||
| Sequence conflict | 279 | 1 | A → S in AAB96884. Ref.1 | ||||||
| Sequence conflict | 279 | 1 | A → S in AAB96886. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A family of LIM domain-associated cofactors confer transcriptional synergism between LIM and Otx homeodomain proteins." Bach I., Carriere C., Ostendorff H.P., Andersen B., Rosenfeld M.G. Genes Dev. 11:1370-1380(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: C57BL/6J. Tissue: Embryonic kidney. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6. Tissue: Brain. |
| [4] | "Characterization of Lhx9, a novel LIM/homeobox gene expressed by the pioneer neurons in the mouse cerebral cortex." Bertuzzi S., Porter F.D., Pitts A., Kumar M., Agulnick A., Wassif C., Westphal H. Mech. Dev. 81:193-198(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LHX9. |
| [5] | "Ubiquitination-dependent cofactor exchange on LIM homeodomain transcription factors." Ostendorff H.P., Peirano R.I., Peters M.A., Schluter A., Bossenz M., Scheffner M., Bach I. Nature 416:99-103(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RLIM, UBIQUITINATION. |
| [6] | "Spliced isoforms of LIM-domain-binding protein (CLIM/NLI/Ldb) lacking the LIM-interaction domain." Tran Y.H., Xu Z., Kato A., Mistry A.C., Goya Y., Taira M., Brandt S.J., Hirose S. J. Biochem. 140:105-119(2006) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U89487 mRNA. Translation: AAB96884.1. U89489 mRNA. Translation: AAB96886.1. AK147160 mRNA. Translation: BAE27725.1. AK146860 mRNA. Translation: BAE27488.1. BC079611 mRNA. Translation: AAH79611.1. |
| IPI | IPI00116609. IPI00607962. IPI00798495. |
| RefSeq | NP_001070866.1. NM_001077398.1. NP_034828.3. NM_010698.3. |
| UniGene | Mm.25785. |
3D structure databases | |
| ProteinModelPortal | O55203. |
| SMR | O55203. Positions 298-325. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-46444N. |
PTM databases | |
| PhosphoSite | O55203. |
Proteomic databases | |
| PaxDb | O55203. |
| PRIDE | O55203. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000070748; ENSMUSP00000067737; ENSMUSG00000039706. |
| GeneID | 16826. |
| KEGG | mmu:16826. |
| UCSC | uc008xis.1. mouse. uc008xit.1. mouse. uc008xiu.1. mouse. |
Organism-specific databases | |
| CTD | 9079. |
| MGI | MGI:894670. Ldb2. |
Phylogenomic databases | |
| eggNOG | NOG282114. |
| GeneTree | ENSGT00390000005639. |
| HOGENOM | HOG000030908. |
| HOVERGEN | HBG000135. |
| InParanoid | O55203. |
| OMA | LGNSSPW. |
| OrthoDB | EOG4XWFXV. |
Gene expression databases | |
| Bgee | O55203. |
| CleanEx | MM_LDB2. |
| Genevestigator | O55203. |
| GermOnline | ENSMUSG00000039706. Mus musculus. |
Family and domain databases | |
| InterPro | IPR002691. LIM-dom-bd. [Graphical view] |
| PANTHER | PTHR10378. PTHR10378. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | LDB2. mouse. |
| NextBio | 290728. |
| SOURCE | Search... |
Entry information
| Entry name | LDB2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O55203 Secondary accession number(s): O55205, Q3UHY1, Q6AXE6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
