Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM domain-binding protein 2

Gene

Ldb2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors.

Caution

GO - Molecular functioni

  • enzyme binding Source: UniProtKB
  • LIM domain binding Source: UniProtKB
  • transcription factor activity, transcription factor binding Source: MGI

GO - Biological processi

  • epithelial structure maintenance Source: MGI
  • hair follicle development Source: MGI
  • positive regulation of cellular component biogenesis Source: MGI
  • positive regulation of transcription by RNA polymerase II Source: MGI
  • regulation of cell migration Source: UniProtKB
  • regulation of kinase activity Source: UniProtKB
  • somatic stem cell population maintenance Source: MGI

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain-binding protein 2
Short name:
LDB-2
Alternative name(s):
Carboxyl-terminal LIM domain-binding protein 1
Short name:
CLIM-1
LIM domain-binding factor CLIM1
Gene namesi
Name:Ldb2
Synonyms:Clim1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:894670 Ldb2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000843881 – 373LIM domain-binding protein 2Add BLAST373

Post-translational modificationi

Ubiquitinated by RLIM/RNF12, leading to its degradation by the proteasome.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

MaxQBiO55203
PaxDbiO55203
PeptideAtlasiO55203
PRIDEiO55203

PTM databases

iPTMnetiO55203
PhosphoSitePlusiO55203

Expressioni

Gene expression databases

BgeeiENSMUSG00000039706
CleanExiMM_LDB2
ExpressionAtlasiO55203 baseline and differential
GenevisibleiO55203 MM

Interactioni

Subunit structurei

Interacts with LHX9 (PubMed:10330499). Interacts with SLK; leading to negatively regulate SLK kinase activity (PubMed:19675209).3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
RlimQ9WTV72EBI-15657830,EBI-15657872

GO - Molecular functioni

  • enzyme binding Source: UniProtKB
  • LIM domain binding Source: UniProtKB

Protein-protein interaction databases

BioGridi20112618 interactors.
DIPiDIP-46444N
IntActiO55203 3 interactors.
STRINGi10090.ENSMUSP00000067737

Structurei

3D structure databases

ProteinModelPortaliO55203
SMRiO55203
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni298 – 336LIM-binding domain (LID)By similarityAdd BLAST39

Sequence similaritiesi

Belongs to the LDB family.Curated

Phylogenomic databases

eggNOGiKOG2181 Eukaryota
ENOG410YZVH LUCA
GeneTreeiENSGT00390000005639
HOGENOMiHOG000030908
HOVERGENiHBG000135
InParanoidiO55203
OMAiNSSPWNS
OrthoDBiEOG091G0A0P
PhylomeDBiO55203
TreeFamiTF319923

Family and domain databases

InterProiView protein in InterPro
IPR030174 LDB2
IPR029005 LIM-bd/SEUSS
PANTHERiPTHR10378 PTHR10378, 1 hit
PTHR10378:SF8 PTHR10378:SF8, 1 hit
PfamiView protein in Pfam
PF01803 LIM_bind, 2 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O55203-1) [UniParc]FASTAAdd to basket
Also known as: CLIM-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSTPHDPFY SSPFGPFYRR HTPYMVQPEY RIYEMNKRLQ SRTEDSDNLW
60 70 80 90 100
WDAFATEFFE DDATLTLSFC LEDGPKRYTI GRTLIPRYFS TVFEGGVTDL
110 120 130 140 150
YYILKHSKES YHNSSITVDC DQCAMVTQHG KPMFTKVCTE GRLILEFTFD
160 170 180 190 200
DLMRIKTWHF TIRQYRELVP RSILAMHAQD PQVLDQLSKN ITRMGLTNFT
210 220 230 240 250
LNYLRLCVIL EPMQELMSRH KTYNLSPRDC LKTCLFQKWQ RMVAPPAEPT
260 270 280 290 300
RQPTTKRRKR KNSTSSTSNS SAGNTTNSAG SKKKTPAASL SLATQVPDVM
310 320 330 340 350
VVGEPTLMGG EFGDEDERLI TRLENTQYDA ANGMDDEEDF NNSPALGNNS
360 370
PWNSKPPATQ ETKSENAPPQ ASQ
Length:373
Mass (Da):42,691
Last modified:September 11, 2007 - v2
Checksum:i0748DBAEB5586AB4
GO
Isoform 2 (identifier: O55203-2) [UniParc]FASTAAdd to basket
Also known as: CLIM-1b

The sequence of this isoform differs from the canonical sequence as follows:
     298-331: DVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA → GLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH
     332-373: Missing.

Note: Lacks LIM-binding domain.
Show »
Length:331
Mass (Da):37,929
Checksum:iA4A4131EEF631544
GO
Isoform 3 (identifier: O55203-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-297: Missing.
     298-331: DVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA → GLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH
     332-373: Missing.

Note: No experimental confirmation available.
Show »
Length:329
Mass (Da):37,733
Checksum:i2F09D73318CEA63A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti272A → G in AAB96884 (PubMed:9192866).Curated1
Sequence conflicti272A → G in AAB96886 (PubMed:9192866).Curated1
Sequence conflicti279A → S in AAB96884 (PubMed:9192866).Curated1
Sequence conflicti279A → S in AAB96886 (PubMed:9192866).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027829296 – 297Missing in isoform 3. 1 Publication2
Alternative sequenceiVSP_014369298 – 331DVMVV…QYDAA → GLGAIPNCSLNPGRDGDLCH STAVTPSGQFKEKH in isoform 2 and isoform 3. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_014370332 – 373Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U89487 mRNA Translation: AAB96884.1
U89489 mRNA Translation: AAB96886.1
AK147160 mRNA Translation: BAE27725.1
AK146860 mRNA Translation: BAE27488.1
BC079611 mRNA Translation: AAH79611.1
CCDSiCCDS19271.1 [O55203-1]
CCDS80276.1 [O55203-2]
CCDS80278.1 [O55203-3]
RefSeqiNP_001070866.1, NM_001077398.2 [O55203-3]
NP_001273277.1, NM_001286348.1 [O55203-2]
NP_034828.3, NM_010698.4 [O55203-1]
XP_006503817.1, XM_006503754.3 [O55203-2]
XP_006503819.1, XM_006503756.3 [O55203-3]
UniGeneiMm.25785

Genome annotation databases

EnsembliENSMUST00000070748; ENSMUSP00000067737; ENSMUSG00000039706 [O55203-1]
ENSMUST00000199256; ENSMUSP00000143775; ENSMUSG00000039706 [O55203-3]
ENSMUST00000199534; ENSMUSP00000142442; ENSMUSG00000039706 [O55203-2]
GeneIDi16826
KEGGimmu:16826
UCSCiuc008xis.2 mouse [O55203-3]
uc008xit.2 mouse [O55203-1]
uc008xiu.2 mouse [O55203-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLDB2_MOUSE
AccessioniPrimary (citable) accession number: O55203
Secondary accession number(s): O55205, Q3UHY1, Q6AXE6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: September 11, 2007
Last modified: March 28, 2018
This is version 121 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome