O55143 (AT2A2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 Short name=SERCA2 Short name=SR Ca(2+)-ATPase 2 EC=3.6.3.8 Alternative name(s): Calcium pump 2 Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform Endoplasmic reticulum class 1/2 Ca(2+) ATPase | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 1044 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Isoform SERCA2A is involved in the regulation of the contraction/relaxation cycle By similarity. |
| Catalytic activity | ATP + H2O + Ca2+[side 1] = ADP + phosphate + Ca2+[side 2]. |
| Enzyme regulation | Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN By similarity. |
| Subunit structure | Associated with phospholamban (PLN) By similarity. Isoform SERCA2B interacts with TRAM2 (via C-terminus). Interacts with HAX1 By similarity. Ref.4 |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein. |
| Tissue specificity | Isoform SERCA2A is highly expressed in heart and slow twitch skeletal muscle. Isoform SERCA2B is widely expressed. |
| Post-translational modification | Nitrated under oxidative stress. Nitration on the two tyrosine residues inhibits catalytic activity By similarity. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform SERCA2B (identifier: O55143-1) Also known as: ATP2A2B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SERCA2A (identifier: O55143-2) Also known as: ATP2A2A; The sequence of this isoform differs from the canonical sequence as follows: 995-1044: GKECVQPATKSSCSLSACTDGISWPFVLLIMPLVVWVYSTDTNFSDMFWS → AILE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1044 | 1044 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 | PRO_0000046197 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | Helical; Name=1; By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Name=2; By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | Helical; Name=3; By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | Helical; Name=4; By similarity | ||||||
| Topological domain | 314 – 756 | 443 | Cytoplasmic By similarity | ||||||
| Transmembrane | 757 – 776 | 20 | Helical; Name=5; By similarity | ||||||
| Topological domain | 777 – 786 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 787 – 807 | 21 | Helical; Name=6; By similarity | ||||||
| Topological domain | 808 – 827 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 828 – 850 | 23 | Helical; Name=7; By similarity | ||||||
| Topological domain | 851 – 896 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 897 – 916 | 20 | Helical; Name=8; By similarity | ||||||
| Topological domain | 917 – 929 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 930 – 948 | 19 | Helical; Name=9; By similarity | ||||||
| Topological domain | 949 – 963 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 964 – 984 | 21 | Helical; Name=10; By similarity | ||||||
| Topological domain | 985 – 1044 | 60 | Cytoplasmic By similarity | ||||||
| Region | 370 – 400 | 31 | Interacts with phospholamban 1 By similarity | ||||||
| Region | 575 – 594 | 20 | Interacts with HAX1 By similarity | ||||||
| Region | 787 – 807 | 21 | Interacts with phospholamban 2 By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 702 | 1 | Magnesium By similarity | ||||||
| Metal binding | 706 | 1 | Magnesium By similarity | ||||||
| Metal binding | 767 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 770 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 795 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 798 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 907 | 1 | Calcium 1 By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 294 | 1 | Nitrated tyrosine By similarity | ||||||
| Modified residue | 295 | 1 | Nitrated tyrosine By similarity | ||||||
| Modified residue | 464 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 537 | 1 | Phosphothreonine Ref.6 | ||||||
| Modified residue | 663 | 1 | Phosphoserine Ref.7 | ||||||
| Cross-link | 143 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.5 | |||||||
Natural variations | |||||||||
| Alternative sequence | 995 – 1044 | 50 | GKECV…DMFWS → AILE in isoform SERCA2A. | VSP_000359 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure and organization of the mouse Atp2a2 gene encoding the sarco(endo)plasmic reticulum Ca(2+)-ATPase 2 (SERCA2) isoforms." Ver Heyen M., Reed T.D., Blough R.E., Zilberman A.L., Loukianov E., Van Baelen K., Raeymaekers L., Periasamy M., Wutack F. Mamm. Genome 11:159-163(2000) [PubMed: 10656932] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS SERCA2A AND SERCA2B). Strain: 129/SvJ. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SERCA2B). Strain: C57BL/6. Tissue: Brain. |
| [3] | Lubec G., Kang S.U., Sunyer B., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 604-611 AND 638-655, MASS SPECTROMETRY. Strain: C57BL/6 and OF1. Tissue: Brain and Hippocampus. |
| [4] | "TRAM2 protein interacts with endoplasmic reticulum Ca2+ pump Serca2b and is necessary for collagen type I synthesis." Stefanovic B., Stefanovic L., Schnabl B., Bataller R., Brenner D.A. Mol. Cell. Biol. 24:1758-1768(2004) [PubMed: 14749390] [Abstract] Cited for: INTERACTION WITH TRAM2. |
| [5] | "A proteomics approach to identify the ubiquitinated proteins in mouse heart." Jeon H.B., Choi E.S., Yoon J.H., Hwang J.H., Chang J.W., Lee E.K., Choi H.W., Park Z.-Y., Yoo Y.J. Biochem. Biophys. Res. Commun. 357:731-736(2007) [PubMed: 17451654] [Abstract] Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-143, MASS SPECTROMETRY. Tissue: Heart. |
| [6] | "Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry." Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R. J. Proteome Res. 6:250-262(2007) [PubMed: 17203969] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-537, MASS SPECTROMETRY. Tissue: Liver. |
| [7] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed: 17114649] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-663, MASS SPECTROMETRY. Tissue: Brain cortex. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ131821 mRNA. Translation: CAB72436.1. AJ223584 mRNA. Translation: CAA11450.1. AF029982 Genomic DNA. Translation: AAD01889.1. AJ131870 Genomic DNA. Translation: CAB41017.1. AJ131870 Genomic DNA. Translation: CAB41018.1. BC054531 mRNA. Translation: AAH54531.1. BC054748 mRNA. Translation: AAH54748.1. |
| IPI | IPI00338964. IPI00468900. |
| RefSeq | NP_001103610.1. NM_001110140.3. NP_033852.1. NM_009722.3. |
| UniGene | Mm.227583. |
3D structure databases | |
| ProteinModelPortal | O55143. |
| SMR | O55143. Positions 1-992. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O55143. 3 interactions. |
| STRING | O55143. |
PTM databases | |
| PhosphoSite | O55143. |
Proteomic databases | |
| PRIDE | O55143. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 11938. |
| KEGG | mmu:11938. |
| UCSC | uc008zli.2. mouse. |
Organism-specific databases | |
| CTD | 488. |
| MGI | MGI:88110. Atp2a2. |
Phylogenomic databases | |
| GeneTree | ENSGT00560000076887. |
| HOVERGEN | HBG105648. |
| InParanoid | O55143. |
| OMA | IKYETNL. |
| OrthoDB | EOG4SXNBQ. |
| PhylomeDB | O55143. |
Gene expression databases | |
| ArrayExpress | O55143. |
| Bgee | O55143. |
| Genevestigator | O55143. |
| GermOnline | ENSMUSG00000029467. Mus musculus. |
Family and domain databases | |
| InterPro | IPR023306. ATPase_cation_domN. IPR008250. ATPase_P-typ_ATPase-assoc-dom. IPR005782. ATPase_P-typ_Ca-transp. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023300. ATPase_P-typ_cyto_domA. IPR023299. ATPase_P-typ_cyto_domN. IPR000695. ATPase_P-typ_H-transp. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR005834. Dehalogen-like_hydro. IPR023214. HAD-like_dom. [Graphical view] |
| Gene3D | G3DSA:2.70.150.10. ATPase_P-typ_cyto_domA. 2 hits. G3DSA:3.40.1110.10. ATPase_P-typ_cyto_domN. 1 hit. G3DSA:1.20.1110.10. ATPase_P-typ_TM_dom. 2 hits. |
| KO | K05853. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. PR00120. HATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 2 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 280039. |
| SOURCE | Search... |
Entry information
| Entry name | AT2A2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O55143 Secondary accession number(s): Q9R2A9, Q9WUT5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with