Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptogyrin-1

Gene

Syngr1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the regulation of short-term and long-term synaptic plasticity.1 Publication

GO - Biological processi

  • protein targeting Source: MGI
  • regulation of long-term neuronal synaptic plasticity Source: UniProtKB
  • regulation of short-term neuronal synaptic plasticity Source: UniProtKB
Complete GO annotation...

Protein family/group databases

TCDBi9.B.130.2.5. the tetraspan vesicle membrane protein (tvp) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptogyrin-1
Gene namesi
Name:Syngr1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1328323. Syngr1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei24 – 4421HelicalSequence analysisAdd
BLAST
Transmembranei72 – 9221HelicalSequence analysisAdd
BLAST
Transmembranei104 – 12421HelicalSequence analysisAdd
BLAST
Transmembranei149 – 16921HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Membrane, Synapse

Pathology & Biotechi

Disruption phenotypei

Mice lacking both SYNGR1 and SYP show normal brain structure and composition, but impaired short-term and long-term synaptic plasticity.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 234234Synaptogyrin-1PRO_0000183991Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiO55100.
PaxDbiO55100.
PeptideAtlasiO55100.
PRIDEiO55100.

PTM databases

iPTMnetiO55100.
PhosphoSiteiO55100.

Expressioni

Gene expression databases

BgeeiENSMUSG00000022415.
CleanExiMM_SYNGR1.
ExpressionAtlasiO55100. baseline and differential.
GenevisibleiO55100. MM.

Interactioni

Protein-protein interaction databases

BioGridi203605. 1 interaction.
IntActiO55100. 3 interactions.
STRINGi10090.ENSMUSP00000009727.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini20 – 173154MARVELPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the synaptogyrin family.Curated
Contains 1 MARVEL domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4016. Eukaryota.
ENOG4111F8S. LUCA.
GeneTreeiENSGT00510000046450.
HOGENOMiHOG000220816.
HOVERGENiHBG000896.
InParanoidiO55100.
OMAiWSQWSSA.
OrthoDBiEOG091G0KKK.
PhylomeDBiO55100.
TreeFamiTF320995.

Family and domain databases

InterProiIPR008253. Marvel.
IPR016579. Synaptogyrin.
[Graphical view]
PANTHERiPTHR10838. PTHR10838. 1 hit.
PfamiPF01284. MARVEL. 1 hit.
[Graphical view]
PIRSFiPIRSF011282. Synaptogyrin. 1 hit.
PROSITEiPS51225. MARVEL. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1A (identifier: O55100-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGGAYGAGK AGGAFDPYTL VRQPHTILRV VSWVFSIVVF GSIVNEGYLN
60 70 80 90 100
NPEEEEEFCI YNRNPNACSY GVTVGVLAFL TCLLYLALDV YFPQISSVKD
110 120 130 140 150
RKKAVLSDIG VSAFWAFFWF VGFCFLANQW QVSKPKDNPL NEGTDAARAA
160 170 180 190 200
IAFSFFSIFT WAGQAVLAFQ RYQIGADSAL FSQDYMDPSQ DSSMPYAPYV
210 220 230
EPSAGSDPAG MGGTYQHPAN AFDAEPQGYQ SQGY
Length:234
Mass (Da):25,653
Last modified:May 15, 2002 - v2
Checksum:i09566021DF3E809A
GO
Isoform 1B (identifier: O55100-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-234: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKELTFQEEYNTLFPASAQP

Show »
Length:191
Mass (Da):21,294
Checksum:i966472837A0A1919
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei162 – 23473AGQAV…QSQGY → SLTAALAVRRFKELTFQEEY NTLFPASAQP in isoform 1B. 2 PublicationsVSP_006333Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002306 mRNA. Translation: CAA05323.1.
AK002972 mRNA. Translation: BAB22487.1.
AK010442 mRNA. Translation: BAB26943.1.
AK044007 mRNA. Translation: BAC31736.1.
BC138728 mRNA. Translation: AAI38729.1.
BC138729 mRNA. Translation: AAI38730.1.
CCDSiCCDS27657.1. [O55100-1]
CCDS27658.1. [O55100-2]
RefSeqiNP_033329.1. NM_009303.2. [O55100-2]
NP_997591.1. NM_207708.1. [O55100-1]
UniGeneiMm.230301.
Mm.396243.

Genome annotation databases

EnsembliENSMUST00000009727; ENSMUSP00000009727; ENSMUSG00000022415. [O55100-1]
ENSMUST00000009728; ENSMUSP00000009728; ENSMUSG00000022415. [O55100-2]
GeneIDi20972.
KEGGimmu:20972.
UCSCiuc007wvd.1. mouse. [O55100-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002306 mRNA. Translation: CAA05323.1.
AK002972 mRNA. Translation: BAB22487.1.
AK010442 mRNA. Translation: BAB26943.1.
AK044007 mRNA. Translation: BAC31736.1.
BC138728 mRNA. Translation: AAI38729.1.
BC138729 mRNA. Translation: AAI38730.1.
CCDSiCCDS27657.1. [O55100-1]
CCDS27658.1. [O55100-2]
RefSeqiNP_033329.1. NM_009303.2. [O55100-2]
NP_997591.1. NM_207708.1. [O55100-1]
UniGeneiMm.230301.
Mm.396243.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi203605. 1 interaction.
IntActiO55100. 3 interactions.
STRINGi10090.ENSMUSP00000009727.

Protein family/group databases

TCDBi9.B.130.2.5. the tetraspan vesicle membrane protein (tvp) family.

PTM databases

iPTMnetiO55100.
PhosphoSiteiO55100.

Proteomic databases

MaxQBiO55100.
PaxDbiO55100.
PeptideAtlasiO55100.
PRIDEiO55100.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000009727; ENSMUSP00000009727; ENSMUSG00000022415. [O55100-1]
ENSMUST00000009728; ENSMUSP00000009728; ENSMUSG00000022415. [O55100-2]
GeneIDi20972.
KEGGimmu:20972.
UCSCiuc007wvd.1. mouse. [O55100-1]

Organism-specific databases

CTDi9145.
MGIiMGI:1328323. Syngr1.

Phylogenomic databases

eggNOGiKOG4016. Eukaryota.
ENOG4111F8S. LUCA.
GeneTreeiENSGT00510000046450.
HOGENOMiHOG000220816.
HOVERGENiHBG000896.
InParanoidiO55100.
OMAiWSQWSSA.
OrthoDBiEOG091G0KKK.
PhylomeDBiO55100.
TreeFamiTF320995.

Miscellaneous databases

ChiTaRSiSyngr1. mouse.
PROiO55100.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022415.
CleanExiMM_SYNGR1.
ExpressionAtlasiO55100. baseline and differential.
GenevisibleiO55100. MM.

Family and domain databases

InterProiIPR008253. Marvel.
IPR016579. Synaptogyrin.
[Graphical view]
PANTHERiPTHR10838. PTHR10838. 1 hit.
PfamiPF01284. MARVEL. 1 hit.
[Graphical view]
PIRSFiPIRSF011282. Synaptogyrin. 1 hit.
PROSITEiPS51225. MARVEL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSNG1_MOUSE
AccessioniPrimary (citable) accession number: O55100
Secondary accession number(s): B9EI16, Q543Y5, Q9DCB0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 15, 2002
Last modified: September 7, 2016
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.