Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptogyrin-1

Gene

Syngr1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (By similarity). Involved in the regulation of short-term and long-term synaptic plasticity (PubMed:10595519).By similarity1 Publication

GO - Biological processi

  • cellular response to leukemia inhibitory factor Source: MGI
  • protein targeting Source: MGI
  • regulated exocytosis Source: UniProtKB
  • regulation of long-term neuronal synaptic plasticity Source: UniProtKB
  • regulation of short-term neuronal synaptic plasticity Source: UniProtKB
  • synaptic vesicle membrane organization Source: UniProtKB

Enzyme and pathway databases

ReactomeiR-MMU-6798695 Neutrophil degranulation

Protein family/group databases

TCDBi9.B.130.2.5 the tetraspan vesicle membrane protein (tvp) family

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptogyrin-1Curated
Gene namesi
Name:Syngr1Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1328323 Syngr1

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 23CytoplasmicBy similarityAdd BLAST23
Transmembranei24 – 44HelicalSequence analysisAdd BLAST21
Topological domaini45 – 71LumenalBy similarityAdd BLAST27
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Topological domaini93 – 103CytoplasmicBy similarityAdd BLAST11
Transmembranei104 – 124HelicalSequence analysisAdd BLAST21
Topological domaini125 – 148LumenalBy similarityAdd BLAST24
Transmembranei149 – 169HelicalSequence analysisAdd BLAST21
Topological domaini170 – 234CytoplasmicBy similarityAdd BLAST65

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

Pathology & Biotechi

Disruption phenotypei

Mice lacking both Syngr1 and Syp show normal brain structure and composition, but impaired short-term and long-term synaptic plasticity.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001839911 – 234Synaptogyrin-1Add BLAST234

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiO55100
PaxDbiO55100
PeptideAtlasiO55100
PRIDEiO55100

PTM databases

iPTMnetiO55100
PhosphoSitePlusiO55100

Expressioni

Gene expression databases

BgeeiENSMUSG00000022415
CleanExiMM_SYNGR1
ExpressionAtlasiO55100 baseline and differential
GenevisibleiO55100 MM

Interactioni

Protein-protein interaction databases

BioGridi203605, 1 interactor
IntActiO55100, 3 interactors
STRINGi10090.ENSMUSP00000009727

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 173MARVELPROSITE-ProRule annotationAdd BLAST154

Sequence similaritiesi

Belongs to the synaptogyrin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4016 Eukaryota
ENOG4111F8S LUCA
GeneTreeiENSGT00510000046450
HOGENOMiHOG000220816
HOVERGENiHBG000896
InParanoidiO55100
OMAiNACNYAV
OrthoDBiEOG091G0KKK
PhylomeDBiO55100
TreeFamiTF320995

Family and domain databases

InterProiView protein in InterPro
IPR008253 Marvel
IPR016579 Synaptogyrin
PANTHERiPTHR10838 PTHR10838, 1 hit
PfamiView protein in Pfam
PF01284 MARVEL, 1 hit
PIRSFiPIRSF011282 Synaptogyrin, 1 hit
PROSITEiView protein in PROSITE
PS51225 MARVEL, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1A (identifier: O55100-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGGAYGAGK AGGAFDPYTL VRQPHTILRV VSWVFSIVVF GSIVNEGYLN
60 70 80 90 100
NPEEEEEFCI YNRNPNACSY GVTVGVLAFL TCLLYLALDV YFPQISSVKD
110 120 130 140 150
RKKAVLSDIG VSAFWAFFWF VGFCFLANQW QVSKPKDNPL NEGTDAARAA
160 170 180 190 200
IAFSFFSIFT WAGQAVLAFQ RYQIGADSAL FSQDYMDPSQ DSSMPYAPYV
210 220 230
EPSAGSDPAG MGGTYQHPAN AFDAEPQGYQ SQGY
Length:234
Mass (Da):25,653
Last modified:May 15, 2002 - v2
Checksum:i09566021DF3E809A
GO
Isoform 1B (identifier: O55100-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-234: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKELTFQEEYNTLFPASAQP

Show »
Length:191
Mass (Da):21,294
Checksum:i966472837A0A1919
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006333162 – 234AGQAV…QSQGY → SLTAALAVRRFKELTFQEEY NTLFPASAQP in isoform 1B. 2 PublicationsAdd BLAST73

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002306 mRNA Translation: CAA05323.1
AK002972 mRNA Translation: BAB22487.1
AK010442 mRNA Translation: BAB26943.1
AK044007 mRNA Translation: BAC31736.1
BC138728 mRNA Translation: AAI38729.1
BC138729 mRNA Translation: AAI38730.1
CCDSiCCDS27657.1 [O55100-1]
CCDS27658.1 [O55100-2]
RefSeqiNP_033329.1, NM_009303.2 [O55100-2]
NP_997591.1, NM_207708.1 [O55100-1]
UniGeneiMm.230301
Mm.396243

Genome annotation databases

EnsembliENSMUST00000009727; ENSMUSP00000009727; ENSMUSG00000022415 [O55100-1]
ENSMUST00000009728; ENSMUSP00000009728; ENSMUSG00000022415 [O55100-2]
GeneIDi20972
KEGGimmu:20972
UCSCiuc007wvd.1 mouse [O55100-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSNG1_MOUSE
AccessioniPrimary (citable) accession number: O55100
Secondary accession number(s): B9EI16, Q543Y5, Q9DCB0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 15, 2002
Last modified: May 23, 2018
This is version 135 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health