O54992 (MAPK5_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: MAP kinase-activated protein kinase 5 Short name=MAPK-activated protein kinase 5 Short name=MAPKAP kinase 5 Short name=MAPKAPK-5 EC=2.7.11.1 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 473 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Tumor suppressor serine/threonine-protein kinase involved in mTORC1 signaling and post-transcriptional regulation. Phosphorylates FOXO3, ERK3/MAPK6, ERK4/MAPK4, HSP27/HSPB1, p53/TP53 and RHEB. Acts as a tumor suppressor by mediating Ras-induced senescence and phosphorylating p53/TP53. Involved in post-transcriptional regulation of MYC by mediating phosphorylation of FOXO3: phosphorylation of FOXO3 leads to promote nuclear localization of FOXO3, enabling expression of miR-34b and miR-34c, 2 post-transcriptional regulators of MYC that bind to the 3'UTR of MYC transcript and prevent MYC translation. Acts as a negative regulator of mTORC1 signaling by mediating phosphorylation and inhibition of RHEB. Part of the atypical MAPK signaling via its interaction with ERK3/MAPK6 or ERK4/MAPK4: the precise role of the complex formed with ERK3/MAPK6 or ERK4/MAPK4 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPK (ERK3/MAPK6 or ERK4/MAPK4), ERK3/MAPK6 (or ERK4/MAPK4) is phosphorylated and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6 (or ERK4/MAPK4). Mediates phosphorylation of HSP27/HSPB1 in response to PKA/PRKACA stimulation, inducing F-actin rearrangement. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme regulation | Activated following phosphorylation at Thr-182 by p38-alpha/MAPK14, p38-beta/MAPK11, ERK2/MAPK1, ERK3/MAPK6, and ERK4/MAPK4. Activated by stress-related extracellular stimuli; such as H2O2, arsenite, anisomycin TNF alpha and also PMA and the calcium ionophore A23187; but to a lesser extent. In vitro, activated by SQSTM1. Inhibited by diterpenoid alkaloid noroxoaconitine. |
| Subunit structure | Interacts with SQSTM1 By similarity. Interacts with ERK3/MAPK6 and ERK4/MAPK4 (via FRIEDE motif); the interaction is direct. Interacts with YWHAE; the interaction prevents phosphorylation of HSP27/HSPB1 leading to disrupt F-actin polymerization. |
| Subcellular location | Cytoplasm. Nucleus. Note: Translocates to the cytoplasm following phosphorylation and activation. Interaction with ERK3/MAPK6 or ERK4/MAPK4 and phosphorylation at Thr-182, activates the protein kinase activity, followed by translocation to the cytoplasm. Phosphorylation by PKA/PRKACA at Ser-115 also induces nuclear export. |
| Tissue specificity | Expressed ubiquitously. Ref.1 |
| Post-translational modification | Phosphorylated on Thr-182 ERK3/MAPK6 or ERK4/MAPK4; which is the regulatory phosphorylation site and is located on the T-loop/loop 12, leading to activation. Phosphorylation at Thr-182 by p38-alpha/MAPK14, p38-beta/MAPK11 is subject to debate. Phosphorylated at ser-115 by PKA/PRKACA, leading to localization to the cytoplasm. Autophosphorylated. |
| Disruption phenotype | Phenotypes are different depending on reports. According to a first report, mice are viable and fertile and do not show changes in tissue morphology and behavior: they exhibit the same susceptibility to LPS-induced endotoxic shock as wild-type animals and do not show the defects in LPS-induced biosynthesis of inflammatory cytokines known to occur with Mapkapk2-deficient animals (Ref.5). According to another report, both homozygous and heterozygous mutant mice are highly susceptible to skin carcinogenesis induced by DMBA (Ref.10). According to a third report, mutant show enbryonic lethality around E11 in a C57BL/6 background (Ref.6). |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Contains 1 protein kinase domain. |
| Caution | The role of p38 MAPK kinases is unclear in phosphorylation and activation of Mapkapk5. According to some reports, it interacts and is phosphorylated by p38-alpha/MAPK14 and p38-beta/MAPK11 (Ref.1). According to other reports, it is not activated by p38-alpha/MAPK14 and p38-beta/MAPK11 (Ref.5). An explanation for these discrepancies, might be that the interaction with p38 MAPK kinases is weak and occurs only under specific conditions. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Disease | Tumor suppressor |
| Domain | Coiled coil |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from direct assay Ref.6. Source: MGI nucleusInferred from direct assay Ref.6. Source: MGI |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW protein serine/threonine kinase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O54992-1) Also known as: MK-5 type 1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O54992-2) Also known as: MK-5 type 3; The sequence of this isoform differs from the canonical sequence as follows: 344-408: DLKVSLKPLHSVNNPILRKRKLLGTKPKDGIYIHDHENGTEDSNVALEKLRDVIAQCILPQAGKG → E | ||||||
| Isoform 3 (identifier: O54992-3) Also known as: MK-5 type 4; The sequence of this isoform differs from the canonical sequence as follows: 13-161: Missing. | ||||||
| Isoform 4 (identifier: O54992-4) Also known as: MK-5 type 5; The sequence of this isoform differs from the canonical sequence as follows: 13-161: Missing. 407-408: Missing. | ||||||
| Isoform 5 (identifier: O54992-5) Also known as: MK-5 type 2; The sequence of this isoform differs from the canonical sequence as follows: 407-408: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 473 | 473 | MAP kinase-activated protein kinase 5 | PRO_0000086297 | |||||
Regions | |||||||||
| Domain | 22 – 304 | 283 | Protein kinase | ||||||
| Nucleotide binding | 28 – 36 | 9 | ATP By similarity | ||||||
| Coiled coil | 409 – 440 | 32 | Potential | ||||||
Sites | |||||||||
| Active site | 148 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 51 | 1 | ATP Probable | ||||||
Amino acid modifications | |||||||||
| Modified residue | 115 | 1 | Phosphoserine; by PKA | ||||||
| Modified residue | 182 | 1 | Phosphothreonine; by MAPK11, MAPK14, MAPK4, MAPK6 and PKA | ||||||
| Modified residue | 212 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 214 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 13 – 161 | 149 | Missing in isoform 3 and isoform 4. | VSP_011599 | |||||
| Alternative sequence | 344 – 408 | 65 | DLKVS…QAGKG → E in isoform 2. | VSP_011600 | |||||
| Alternative sequence | 407 – 408 | 2 | Missing in isoform 4 and isoform 5. | VSP_011598 | |||||
Experimental info | |||||||||
| Mutagenesis | 51 | 1 | K → E: No p38-alpha/MAPK14-, p38-beta/MAPK11-, ERK3/MAPK6-, ERK4/MAPK4-induced activation. | ||||||
| Mutagenesis | 51 | 1 | K → R or M: Kinase defective mutant, abolishes activity. | ||||||
| Mutagenesis | 115 | 1 | S → A: Impairs shuttling to the cytoplasm. | ||||||
| Mutagenesis | 115 | 1 | S → D: Mimicks phosphorylation state, lesding to localization to the cytoplasm. | ||||||
| Mutagenesis | 182 | 1 | T → A: Impairs protein kinase activity and shuttling to the cytoplasm. | ||||||
| Mutagenesis | 337 | 1 | L → A: Constitutive active mutant. In a knockin model, mouse display increased amounts of head dips and open arm time on the maze, compared to littermate controls. In addition, they also explore further into the open arm on the elevated plus maze and are less active in the closed arm compared to littermate controls. Male knockin mice display no differences in anxiety, but their locomotor activity increases compared to non-transgenic littermates. | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "MAPKAPK5, a novel mitogen-activated protein kinase (MAPK)-activated protein kinase, is a substrate of the extracellular-regulated kinase (ERK) and p38 kinase." Ni H., Wang X.S., Diener K., Yao Z. Biochem. Biophys. Res. Commun. 243:492-496(1998) [PubMed: 9480836] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, MUTAGENESIS OF LYS-51, ENZYME REGULATION, PHOSPHORYLATION BY ERK2/MAPK1 AND MAPK14. Tissue: Spleen. |
| [2] | "Novel splice variants of MK5 from mouse heart." Benoit M.-J., Moise N., Mamarbachi A.M., Allen B.G. Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5). |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N-3. Tissue: Mammary tumor. |
| [5] | "Elimination of protein kinase MK5/PRAK activity by targeted homologous recombination." Shi Y., Kotlyarov A., Laabeta K., Gruber A.D., Butt E., Marcus K., Meyer H.E., Friedrich A., Volk H.D., Gaestel M. Mol. Cell. Biol. 23:7732-7741(2003) [PubMed: 14560018] [Abstract] Cited for: DISRUPTION PHENOTYPE. |
| [6] | "Scaffolding by ERK3 regulates MK5 in development." Schumacher S., Laass K., Kant S., Shi Y., Visel A., Gruber A.D., Kotlyarov A., Gaestel M. EMBO J. 23:4770-4779(2004) [PubMed: 15538386] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF MAPK6, SUBCELLULAR LOCATION, INTERACTION WITH MAPK6, AUTOPHOSPHORYLATION, PHOSPHORYLATION AT THR-182, MUTAGENESIS OF LYS-51 AND THR-182, DISRUPTION PHENOTYPE. |
| [7] | "Activation of MK5/PRAK by the atypical MAP kinase ERK3 defines a novel signal transduction pathway." Seternes O.M., Mikalsen T., Johansen B., Michaelsen E., Armstrong C.G., Morrice N.A., Turgeon B., Meloche S., Moens U., Keyse S.M. EMBO J. 23:4780-4791(2004) [PubMed: 15577943] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF MAPK6, SUBCELLULAR LOCATION, INTERACTION WITH MAPK6, PHOSPHORYLATION AT THR-182, MUTAGENESIS OF THR-182. |
| [8] | "Characterization of the atypical MAPK ERK4 and its activation of the MAPK-activated protein kinase MK5." Kant S., Schumacher S., Singh M.K., Kispert A., Kotlyarov A., Gaestel M. J. Biol. Chem. 281:35511-35519(2006) [PubMed: 16973613] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF MAPK4, SUBCELLULAR LOCATION, INTERACTION WITH MAPK4. |
| [9] | "Transgenic mice expressing constitutive active MAPKAPK5 display gender-dependent differences in exploration and activity." Gerits N., Van Belle W., Moens U. Behav. Brain Funct. 3:58-58(2007) [PubMed: 17997833] [Abstract] Cited for: MUTAGENESIS OF LEU-337. |
| [10] | "PRAK is essential for ras-induced senescence and tumor suppression." Sun P., Yoshizuka N., New L., Moser B.A., Li Y., Liao R., Xie C., Chen J., Deng Q., Yamout M., Dong M.Q., Frangou C.G., Yates J.R. III, Wright P.E., Han J. Cell 128:295-308(2007) [PubMed: 17254968] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF TP53, DISRUPTION PHENOTYPE, MUTAGENESIS OF LYS-51 AND THR-182. |
| [11] | "Modulation of F-actin rearrangement by the cyclic AMP/cAMP-dependent protein kinase (PKA) pathway is mediated by MAPK-activated protein kinase 5 and requires PKA-induced nuclear export of MK5." Gerits N., Mikalsen T., Kostenko S., Shiryaev A., Johannessen M., Moens U. J. Biol. Chem. 282:37232-37243(2007) [PubMed: 17947239] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "The Ser(186) phospho-acceptor site within ERK4 is essential for its ability to interact with and activate PRAK/MK5." Perander M., Aberg E., Johansen B., Dreyer B., Guldvik I.J., Outzen H., Keyse S.M., Seternes O.M. Biochem. J. 411:613-622(2008) [PubMed: 18248330] [Abstract] Cited for: INTERACTION WITH MAPK4. |
| [13] | "Determinants that control the distinct subcellular localization of p38alpha-PRAK and p38beta-PRAK complexes." Li Q., Zhang N., Zhang D., Wang Y., Lin T., Wang Y., Zhou H., Ye Z., Zhang F., Lin S.C., Han J. J. Biol. Chem. 283:11014-11023(2008) [PubMed: 18268017] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [14] | "Activation loop phosphorylation of the atypical MAP kinases ERK3 and ERK4 is required for binding, activation and cytoplasmic relocalization of MK5." Deleris P., Rousseau J., Coulombe P., Rodier G., Tanguay P.L., Meloche S. J. Cell. Physiol. 217:778-788(2008) [PubMed: 18720373] [Abstract] Cited for: INTERACTION WITH MAPK4 AND MAPK6. |
| [15] | "Docking of PRAK/MK5 to the atypical MAPKs ERK3 and ERK4 defines a novel MAPK interaction motif." Aberg E., Torgersen K.M., Johansen B., Keyse S.M., Perander M., Seternes O.M. J. Biol. Chem. 284:19392-19401(2009) [PubMed: 19473979] [Abstract] Cited for: INTERACTION WITH MAPK4 AND MAPK6. |
| [16] | "The diterpenoid alkaloid noroxoaconitine is a Mapkap kinase 5 (MK5/PRAK) inhibitor." Kostenko S., Khan M.T., Sylte I., Moens U. Cell. Mol. Life Sci. 68:289-301(2011) [PubMed: 20640477] [Abstract] Cited for: CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, ENZYME REGULATION, MUTAGENESIS OF THR-182. |
| [17] | "Serine residue 115 of MAPK-activated protein kinase MK5 is crucial for its PKA-regulated nuclear export and biological function." Kostenko S., Shiryaev A., Gerits N., Dumitriu G., Klenow H., Johannessen M., Moens U. Cell. Mol. Life Sci. 68:847-862(2011) [PubMed: 20734105] [Abstract] Cited for: PHOSPHORYLATION AT SER-115, SUBCELLULAR LOCATION, MUTAGENESIS OF SER-115. |
| [18] | "Distinct roles of MK2 and MK5 in cAMP/PKA- and stress/p38MAPK-induced heat shock protein 27 phosphorylation." Shiryaev A., Dumitriu G., Moens U. J. Mol. Signal. 6:4-4(2011) [PubMed: 21575178] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF HSPB1. |
| [19] | "Inactivation of Rheb by PRAK-mediated phosphorylation is essential for energy-depletion-induced suppression of mTORC1." Zheng M., Wang Y.H., Wu X.N., Wu S.Q., Lu B.J., Dong M.Q., Zhang H., Sun P., Lin S.C., Guan K.L., Han J. Nat. Cell Biol. 13:263-272(2011) [PubMed: 21336308] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF RHEB, MUTAGENESIS OF LYS-51. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF039840 mRNA. Translation: AAC40047.1. AY533679 mRNA. Translation: AAS22330.1. AY533680 mRNA. Translation: AAS22331.2. AY533681 mRNA. Translation: AAS22332.1. AY533682 mRNA. Translation: AAS22333.1. AC155316 Genomic DNA. No translation available. BC019184 mRNA. Translation: AAH19184.1. |
| IPI | IPI00120068. IPI00462486. IPI00462487. IPI00462488. IPI00850634. |
| PIR | JC5952. |
| RefSeq | NP_034895.1. NM_010765.2. |
| UniGene | Mm.272206. |
3D structure databases | |
| ProteinModelPortal | O54992. |
| SMR | O54992. Positions 11-458. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O54992. 2 interactions. |
| STRING | O54992. |
PTM databases | |
| PhosphoSite | O54992. |
Proteomic databases | |
| PRIDE | O54992. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000031410; ENSMUSP00000031410; ENSMUSG00000029454. ENSMUST00000111782; ENSMUSP00000107412; ENSMUSG00000029454. ENSMUST00000111783; ENSMUSP00000107413; ENSMUSG00000029454. ENSMUST00000111786; ENSMUSP00000107416; ENSMUSG00000029454. ENSMUST00000111787; ENSMUSP00000107417; ENSMUSG00000029454. ENSMUST00000153763; ENSMUSP00000119182; ENSMUSG00000029454. |
| GeneID | 17165. |
| KEGG | mmu:17165. |
| UCSC | uc008zjq.1. mouse. uc008zjr.1. mouse. uc008zjs.1. mouse. |
Organism-specific databases | |
| CTD | 8550. |
| MGI | MGI:1333110. Mapkapk5. |
Phylogenomic databases | |
| eggNOG | roNOG12773. |
| GeneTree | ENSGT00550000074510. |
| HOGENOM | HBG755340. |
| HOVERGEN | HBG106948. |
| InParanoid | O54992. |
| OMA | QVTKQIA. |
| OrthoDB | EOG43JC4K. |
Gene expression databases | |
| ArrayExpress | O54992. |
| Bgee | O54992. |
| CleanEx | MM_MAPKAPK5. |
| Genevestigator | O54992. |
| GermOnline | ENSMUSG00000029454. Mus musculus. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017442. Se/Thr_kinase-like_dom. IPR008271. Ser/Thr_kinase_AS. IPR002290. Ser/Thr_kinase_dom. [Graphical view] |
| KO | K04442. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 291446. |
| SOURCE | Search... |
Entry information
| Entry name | MAPK5_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O54992 Secondary accession number(s): E9QQ45 Q6QME7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with