Reviewed,
UniProtKB/Swiss-Prot O54992 (MAPK5_MOUSE)
Last modified
November 3, 2009.
Version 79.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: MAP kinase-activated protein kinase 5 Short name=MAPK-activated protein kinase 5 Short name=MAPKAP kinase 5 EC=2.7.11.1 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 473 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Mediates stress-induced small heat shock protein 27 phosphorylation By similarity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme regulation | In vivo, p38 alpha and beta-dependent phosphorylation increases PRAK activity By similarity. In vitro, ERK also activates MAPKAPK5. Activated by stress-related extracellular stimuli; such as H2O2, arsenite, anisomycin TNF alpha and also PMA and the calcium ionophore A23187; but to a lesser extent. In vitro, activated by SQSTM1 By similarity. |
| Subunit structure | Interacts with SQSTM1 By similarity. |
| Subcellular location | Cytoplasm Probable. Nucleus By similarity. Note: Also observed in the nucleus By similarity. |
| Tissue specificity | Expressed ubiquitously. Ref.1 |
| Post-translational modification | Phosphorylated on Thr-182; which is the regulatory phosphorylation site and is located on the T-loop/loop 12 By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | protein amino acid phosphorylation Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytoplasm Inferred from direct assay. Source: MGI nucleusInferred from direct assay. Source: MGI |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW protein bindingInferred from physical interaction. Source: IntAct protein serine/threonine kinase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HSPB1 | P04792 | 1 | EBI-1202132,EBI-352682 | From a different organism. |
| Tp53 | P02340 | 1 | EBI-1202132,EBI-474016 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O54992-1) Also known as: MK-5 type 1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: O54992-2) Also known as: MK-5 type 3; The sequence of this isoform differs from the canonical sequence as follows: 344-408: DLKVSLKPLHSVNNPILRKRKLLGTKPKDGIYIHDHENGTEDSNVALEKLRDVIAQCILPQAGKG → E | ||||||
| Isoform 3 (identifier: O54992-3) Also known as: MK-5 type 4; The sequence of this isoform differs from the canonical sequence as follows: 13-161: Missing. | ||||||
| Isoform 4 (identifier: O54992-4) Also known as: MK-5 type 5; The sequence of this isoform differs from the canonical sequence as follows: 13-161: Missing. 407-408: Missing. | ||||||
| Isoform 5 (identifier: O54992-5) Also known as: MK-5 type 2; The sequence of this isoform differs from the canonical sequence as follows: 407-408: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 473 | 473 | MAP kinase-activated protein kinase 5 | PRO_0000086297 | |||||
Regions | |||||||||
| Domain | 22 – 304 | 283 | Protein kinase | ||||||
| Nucleotide binding | 28 – 36 | 9 | ATP By similarity | ||||||
| Coiled coil | 409 – 440 | 32 | Potential | ||||||
Sites | |||||||||
| Active site | 148 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 51 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 182 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 13 – 161 | 149 | Missing in isoform 3 and isoform 4. | VSP_011599 | |||||
| Alternative sequence | 344 – 408 | 65 | DLKVS…QAGKG → E in isoform 2. | VSP_011600 | |||||
| Alternative sequence | 407 – 408 | 2 | Missing in isoform 4 and isoform 5. | VSP_011598 | |||||
Experimental info | |||||||||
| Mutagenesis | 51 | 1 | K → E: No p38-/ERK-induced activation. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "MAPKAPK5, a novel mitogen-activated protein kinase (MAPK)-activated protein kinase, is a substrate of the extracellular-regulated kinase (ERK) and p38 kinase." Ni H., Wang X.S., Diener K., Yao Z. Biochem. Biophys. Res. Commun. 243:492-496(1998) [PubMed: 9480836] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, MUTAGENESIS OF LYS-51, ENZYME REGULATION. Tissue: Spleen. |
| [2] | "Novel splice variants of MK5 from mouse heart." Benoit M.-J., Moise N., Mamarbachi A.M., Allen B.G. Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5). |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N-3. Tissue: Mammary tumor. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF039840 mRNA. Translation: AAC40047.1. AY533679 mRNA. Translation: AAS22330.1. AY533680 mRNA. Translation: AAS22331.2. AY533681 mRNA. Translation: AAS22332.1. AY533682 mRNA. Translation: AAS22333.1. BC019184 mRNA. Translation: AAH19184.1. | |
| IPI | IPI00120068. IPI00462486. IPI00462487. IPI00462488. IPI00850634. |
| PIR | JC5952. |
| RefSeq | NP_034895.1. XP_001479292.1. |
| UniGene | Mm.272206 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1KWP based on UniProtKB P49137. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O54992. 2 interactions. |
| STRING | O54992. |
PTM databases | |
| PhosphoSite | O54992. |
Proteomic databases | |
| PRIDE | O54992. |
Genome annotation databases | |
| Ensembl | ENSMUST00000031410; ENSMUSP00000031410; ENSMUSG00000029454; Mus musculus. [Genome view] ENSMUST00000111786; ENSMUSP00000107416; ENSMUSG00000029454; Mus musculus. [Genome view] ENSMUST00000111787; ENSMUSP00000107417; ENSMUSG00000029454; Mus musculus. [Genome view] |
| GeneID | 17165. |
| KEGG | mmu:100047833. mmu:17165. |
| UCSC | uc008zjq.1. mouse. uc008zjr.1. mouse. uc008zjs.1. mouse. |
Organism-specific databases | |
| CTD | 17165. |
| MGI | MGI:1333110. Mapkapk5. |
Phylogenomic databases | |
| HOGENOM | O54992. |
| HOVERGEN | O54992. |
| OMA | EYSINWT. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.1. 244. |
Gene expression databases | |
| ArrayExpress | O54992. |
| Bgee | O54992. |
| CleanEx | MM_MAPKAPK5. |
| Genevestigator | O54992. |
| GermOnline | ENSMUSG00000029454. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| ProDom | PD000001. Prot_kinase. 2 hits. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 291446. |
| SOURCE | Search... |
Entry information
| Entry name | MAPK5_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O54992 Secondary accession number(s): Q6QME4 Q6QME7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


