Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RalBP1-associated Eps domain-containing protein 1

Gene

Reps1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May coordinate the cellular actions of activated EGF receptors and Ral-GTPases.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi331 – 342PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-MMU-8856825. Cargo recognition for clathrin-mediated endocytosis.
R-MMU-8856828. Clathrin-mediated endocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
RalBP1-associated Eps domain-containing protein 1
Alternative name(s):
RalBP1-interacting protein 1
Gene namesi
Name:Reps1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1196373. Reps1.

Subcellular locationi

  • Membraneclathrin-coated pit By similarity

  • Note: Colocalize with ITSN1 at the plasma membrane in structures that are most probably clathrin-coated pits.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Coated pit, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000738301 – 795RalBP1-associated Eps domain-containing protein 1Add BLAST795

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei145PhosphoserineBy similarity1
Modified residuei162PhosphoserineBy similarity1
Modified residuei166PhosphoserineBy similarity1
Modified residuei170PhosphoserineBy similarity1
Modified residuei173PhosphothreonineBy similarity1
Modified residuei272PhosphoserineCombined sources1
Modified residuei273PhosphoserineCombined sources1
Modified residuei288PhosphotyrosineSequence analysis1
Modified residuei307PhosphoserineBy similarity1
Modified residuei475PhosphoserineBy similarity1
Modified residuei482PhosphoserineBy similarity1
Modified residuei489PhosphoserineBy similarity1
Modified residuei539PhosphoserineCombined sources1
Modified residuei543PhosphothreonineCombined sources1
Modified residuei561PhosphoserineBy similarity1
Modified residuei708PhosphoserineCombined sources1
Modified residuei739PhosphoserineBy similarity1

Post-translational modificationi

EGF stimulates phosphorylation on Tyr-residues.

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO54916.
MaxQBiO54916.
PaxDbiO54916.
PeptideAtlasiO54916.
PRIDEiO54916.

PTM databases

iPTMnetiO54916.
PhosphoSitePlusiO54916.

Expressioni

Tissue specificityi

Expressed in all tissues examined. The highest level expression was found in the kidney and testis.

Gene expression databases

BgeeiENSMUSG00000019854.
CleanExiMM_REPS1.
ExpressionAtlasiO54916. baseline and differential.
GenevisibleiO54916. MM.

Interactioni

Subunit structurei

Homodimer (Potential). Interacts with RALBP1, CRK and GRB2. Binding to RALBP1 does not affect its Ral-binding activity. Forms a complex with the SH3 domains of CRK and GRB2 which may link it to an EGF-responsive tyrosine kinase. Interacts with RAB11FIP2 (By similarity). Interacts with AMPH, ITSN1 (via SH3 domains) and SGIP1; may be involved in clathrin-mediated endocytosis (By similarity).By similarityCurated

GO - Molecular functioni

Protein-protein interaction databases

BioGridi202861. 1 interactor.
IntActiO54916. 4 interactors.
MINTiMINT-1592094.
STRINGi10090.ENSMUSP00000123238.

Structurei

Secondary structure

1795
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi283 – 293Combined sources11
Turni294 – 296Combined sources3
Beta strandi303 – 305Combined sources3
Helixi306 – 316Combined sources11
Helixi320 – 330Combined sources11
Beta strandi335 – 339Combined sources5
Helixi340 – 355Combined sources16

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1FI6NMR-A279-370[»]
ProteinModelPortaliO54916.
SMRiO54916.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO54916.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini10 – 113EH 1PROSITE-ProRule annotationAdd BLAST104
Domaini285 – 374EH 2PROSITE-ProRule annotationAdd BLAST90
Domaini318 – 353EF-handPROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni651 – 795Interaction with RALBP1Add BLAST145

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili750 – 790Sequence analysisAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi540 – 603Pro-richAdd BLAST64

Sequence similaritiesi

Contains 1 EF-hand domain.PROSITE-ProRule annotation
Contains 2 EH domains.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IRAU. Eukaryota.
ENOG410ZSYS. LUCA.
GeneTreeiENSGT00760000118985.
HOGENOMiHOG000231382.
HOVERGENiHBG056372.
InParanoidiO54916.
KOiK20068.
OMAiSHDPVQP.
OrthoDBiEOG091G028Q.
PhylomeDBiO54916.
TreeFamiTF316546.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR000261. EH_dom.
[Graphical view]
PfamiPF12763. EF-hand_4. 1 hit.
[Graphical view]
SMARTiSM00027. EH. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 2 hits.
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 1 hit.
PS50031. EH. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O54916-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGLTLSDAE QKYYSDLFSY CDIESTKKVV VNGRVLELFR AAQLPNDVVL
60 70 80 90 100
QIMELCGATR LGYFGRSQFY IALKLVAVAQ SGFPLRVESI NTVKDLPLPR
110 120 130 140 150
FVASKNEQES RLAASYSSDS ENQGSYSGVI PPPPGRGQVK KGPGSHDAVQ
160 170 180 190 200
PRPSAEQQEP VSPVVSPQQS PPTSPHTWRK HSRHPSGGNS ERPLTGPGPF
210 220 230 240 250
WSPFGDAQAG SSAGDAVWSG QSPPPPQDNW VSFADTPPTS ALLTMHPASV
260 270 280 290 300
QDQTTVRTVA SAATANEIRR QSSSYEDPWK ITDEQRQYYV NQFKTIQPDL
310 320 330 340 350
NGFIPGSAAK EFFTKSKLPI LELSHIWELS DFDKDGALTL DEFCAAFHLV
360 370 380 390 400
VARKNGYDLP EKLPESLMPK LIDLEDSADV GEQPGEVGYS GSPAEAPPSK
410 420 430 440 450
SPSMPSLNQT WPELNQSSEQ WETFSERSSS SQTLTQFDSN IAPADPDTAI
460 470 480 490 500
VHPVPIRMTP SKIHMQEMEL KRTSSDHTNP TSPLLVKPSD LSEENKINSS
510 520 530 540 550
VKFPSGNTVD GYSSSDSFPS DPEQIGSSVT RQRSHSGTSP DNTAPPPPPP
560 570 580 590 600
RPQPSHSRSS SLDMNRTFAV TTGQQQAGVV AHPPAVPPRP QPSQAPGPSV
610 620 630 640 650
HRPVDADGLI THTSTSPQQI PEQPNFADFS QFEVFAASNV SEEQDSEAEK
660 670 680 690 700
HPEVLPAEKA SDPSSSLRAA QADSKAEEKT ATNVPANVSK GTTPLAPPPK
710 720 730 740 750
PVRRRLKSED ELRPDVDEHT QKTGVLAAVL TSQPSIPRSV GKDKKAIQAS
760 770 780 790
IRRNKETNTV LARLNSELQQ QLKDVLEERI SLEVQLEQLR PFSHL
Length:795
Mass (Da):86,519
Last modified:November 3, 2009 - v2
Checksum:i98D788160F560509
GO
Isoform 2 (identifier: O54916-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: Missing.
     420-454: QWETFSERSSSSQTLTQFDSNIAPADPDTAIVHPV → VSKTSLSLLEISLFTGRSFKQDRFTAGYLQYAHTP
     455-795: Missing.

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:210
Mass (Da):23,378
Checksum:i0F50314C618EC731
GO
Isoform 3 (identifier: O54916-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     420-446: Missing.

Show »
Length:716
Mass (Da):77,614
Checksum:i2D37A40F959AA466
GO
Isoform 4 (identifier: O54916-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.

Show »
Length:743
Mass (Da):80,626
Checksum:i205B87DD9D8AC3A6
GO

Sequence cautioni

The sequence BAE29439 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAE30291 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti161V → A in AAB94736 (PubMed:9395447).Curated1
Sequence conflicti605D → N in BAE29439 (PubMed:16141072).Curated1
Sequence conflicti701P → T in BAE29439 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0383371 – 244Missing in isoform 2. 1 PublicationAdd BLAST244
Alternative sequenceiVSP_0383361 – 52Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST52
Alternative sequenceiVSP_007956420 – 454QWETF…IVHPV → VSKTSLSLLEISLFTGRSFK QDRFTAGYLQYAHTP in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_038338420 – 446Missing in isoform 3. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_007957455 – 795Missing in isoform 2. 1 PublicationAdd BLAST341

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF031939 mRNA. Translation: AAB94736.1.
AK150284 mRNA. Translation: BAE29439.1. Different initiation.
AK151309 mRNA. Translation: BAE30291.1. Different initiation.
AK041967 mRNA. Translation: BAC31117.1.
AC153433 Genomic DNA. No translation available.
BC002256 mRNA. No translation available.
BC087547 mRNA. Translation: AAH87547.1.
CCDSiCCDS23710.2. [O54916-1]
PIRiT09173.
RefSeqiNP_001104535.1. NM_001111065.1.
NP_033074.2. NM_009048.2. [O54916-1]
UniGeneiMm.4479.

Genome annotation databases

EnsembliENSMUST00000126390; ENSMUSP00000123238; ENSMUSG00000019854. [O54916-1]
GeneIDi19707.
KEGGimmu:19707.
UCSCiuc007ema.2. mouse. [O54916-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF031939 mRNA. Translation: AAB94736.1.
AK150284 mRNA. Translation: BAE29439.1. Different initiation.
AK151309 mRNA. Translation: BAE30291.1. Different initiation.
AK041967 mRNA. Translation: BAC31117.1.
AC153433 Genomic DNA. No translation available.
BC002256 mRNA. No translation available.
BC087547 mRNA. Translation: AAH87547.1.
CCDSiCCDS23710.2. [O54916-1]
PIRiT09173.
RefSeqiNP_001104535.1. NM_001111065.1.
NP_033074.2. NM_009048.2. [O54916-1]
UniGeneiMm.4479.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1FI6NMR-A279-370[»]
ProteinModelPortaliO54916.
SMRiO54916.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202861. 1 interactor.
IntActiO54916. 4 interactors.
MINTiMINT-1592094.
STRINGi10090.ENSMUSP00000123238.

PTM databases

iPTMnetiO54916.
PhosphoSitePlusiO54916.

Proteomic databases

EPDiO54916.
MaxQBiO54916.
PaxDbiO54916.
PeptideAtlasiO54916.
PRIDEiO54916.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000126390; ENSMUSP00000123238; ENSMUSG00000019854. [O54916-1]
GeneIDi19707.
KEGGimmu:19707.
UCSCiuc007ema.2. mouse. [O54916-1]

Organism-specific databases

CTDi85021.
MGIiMGI:1196373. Reps1.

Phylogenomic databases

eggNOGiENOG410IRAU. Eukaryota.
ENOG410ZSYS. LUCA.
GeneTreeiENSGT00760000118985.
HOGENOMiHOG000231382.
HOVERGENiHBG056372.
InParanoidiO54916.
KOiK20068.
OMAiSHDPVQP.
OrthoDBiEOG091G028Q.
PhylomeDBiO54916.
TreeFamiTF316546.

Enzyme and pathway databases

ReactomeiR-MMU-8856825. Cargo recognition for clathrin-mediated endocytosis.
R-MMU-8856828. Clathrin-mediated endocytosis.

Miscellaneous databases

ChiTaRSiReps1. mouse.
EvolutionaryTraceiO54916.
PROiO54916.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000019854.
CleanExiMM_REPS1.
ExpressionAtlasiO54916. baseline and differential.
GenevisibleiO54916. MM.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR000261. EH_dom.
[Graphical view]
PfamiPF12763. EF-hand_4. 1 hit.
[Graphical view]
SMARTiSM00027. EH. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 2 hits.
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 1 hit.
PS50031. EH. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiREPS1_MOUSE
AccessioniPrimary (citable) accession number: O54916
Secondary accession number(s): Q3UAM3
, Q5PPQ9, Q8C9J9, Q99LR8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: November 3, 2009
Last modified: November 2, 2016
This is version 144 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.