O54916 (REPS1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RalBP1-associated Eps domain-containing protein 1 Alternative name(s): RalBP1-interacting protein 1 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 795 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May coordinate the cellular actions of activated EGF receptors and Ral-GTPases. |
| Subunit structure | Homodimer Potential. Interacts with RALBP1, CRK and GRB2. Binding to RALBP1 does not affect its Ral-binding activity. Forms a complex with the SH3 domains of CRK and GRB2 which may link it to an EGF-responsive tyrosine kinase. Interacts with RAB11FIP2 By similarity. Interacts with AMPH, ITSN1 (via SH3 domains) and SGIP1; may be involved in clathrin-mediated endocytosis By similarity. |
| Subcellular location | Membrane › clathrin-coated pit By similarity. Note: Colocalize with ITSN1 at the plasma membrane in structures that are most probably clathrin-coated pits By similarity. |
| Tissue specificity | Expressed in all tissues examined. The highest level expression was found in the kidney and testis. |
| Post-translational modification | EGF stimulates phosphorylation on Tyr-residues. |
| Sequence similarities | Contains 1 EF-hand domain. Contains 2 EH domains. |
| Sequence caution | The sequence BAE29439.1 differs from that shown. Reason: Erroneous initiation. The sequence BAE30291.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Coated pit Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Repeat |
| Ligand | Calcium Metal-binding |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | receptor-mediated endocytosis Inferred from electronic annotation. Source: InterPro |
| Cellular_component | coated pit Inferred from electronic annotation. Source: UniProtKB-SubCell plasma membraneInferred from electronic annotation. Source: Compara |
| Molecular_function | calcium ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O54916-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O54916-2) The sequence of this isoform differs from the canonical sequence as follows: 1-244: Missing. 420-454: QWETFSERSSSSQTLTQFDSNIAPADPDTAIVHPV → VSKTSLSLLEISLFTGRSFKQDRFTAGYLQYAHTP 455-795: Missing. | ||||||
| Note: Due to intron retention. No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O54916-3) The sequence of this isoform differs from the canonical sequence as follows: 1-52: Missing. 420-446: Missing. | ||||||
| Isoform 4 (identifier: O54916-4) The sequence of this isoform differs from the canonical sequence as follows: 1-52: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||
Molecule processing | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 795 | 795 | RalBP1-associated Eps domain-containing protein 1 | PRO_0000073830 | ||||||||||||||||
Regions | ||||||||||||||||||||
| Domain | 10 – 113 | 104 | EH 1 | |||||||||||||||||
| Domain | 285 – 374 | 90 | EH 2 | |||||||||||||||||
| Domain | 318 – 353 | 36 | EF-hand | |||||||||||||||||
| Calcium binding | 331 – 342 | 12 | Potential | |||||||||||||||||
| Region | 651 – 795 | 145 | Interaction with RALBP1 | |||||||||||||||||
| Coiled coil | 750 – 790 | 41 | Potential | |||||||||||||||||
| Compositional bias | 540 – 603 | 64 | Pro-rich | |||||||||||||||||
Amino acid modifications | ||||||||||||||||||||
| Modified residue | 145 | 1 | Phosphoserine By similarity | |||||||||||||||||
| Modified residue | 162 | 1 | Phosphoserine By similarity | |||||||||||||||||
| Modified residue | 166 | 1 | Phosphoserine By similarity | |||||||||||||||||
| Modified residue | 170 | 1 | Phosphoserine By similarity | |||||||||||||||||
| Modified residue | 173 | 1 | Phosphothreonine By similarity | |||||||||||||||||
| Modified residue | 174 | 1 | Phosphoserine By similarity | |||||||||||||||||
| Modified residue | 186 | 1 | Phosphoserine Ref.6 | |||||||||||||||||
| Modified residue | 272 | 1 | Phosphoserine Ref.5 | |||||||||||||||||
| Modified residue | 288 | 1 | Phosphotyrosine Potential | |||||||||||||||||
| Modified residue | 307 | 1 | Phosphoserine By similarity | |||||||||||||||||
| Modified residue | 489 | 1 | Phosphoserine By similarity | |||||||||||||||||
| Modified residue | 539 | 1 | Phosphoserine By similarity | |||||||||||||||||
| Modified residue | 561 | 1 | Phosphoserine Ref.7 | |||||||||||||||||
| Modified residue | 708 | 1 | Phosphoserine Ref.6 Ref.7 | |||||||||||||||||
| Modified residue | 739 | 1 | Phosphoserine By similarity | |||||||||||||||||
Natural variations | ||||||||||||||||||||
| Alternative sequence | 1 – 244 | 244 | Missing in isoform 2. | VSP_038337 | ||||||||||||||||
| Alternative sequence | 1 – 52 | 52 | Missing in isoform 3 and isoform 4. | VSP_038336 | ||||||||||||||||
| Alternative sequence | 420 – 454 | 35 | QWETF…IVHPV → VSKTSLSLLEISLFTGRSFK QDRFTAGYLQYAHTP in isoform 2. | VSP_007956 | ||||||||||||||||
| Alternative sequence | 420 – 446 | 27 | Missing in isoform 3. | VSP_038338 | ||||||||||||||||
| Alternative sequence | 455 – 795 | 341 | Missing in isoform 2. | VSP_007957 | ||||||||||||||||
Experimental info | ||||||||||||||||||||
| Sequence conflict | 161 | 1 | V → A in AAB94736. Ref.1 | |||||||||||||||||
| Sequence conflict | 605 | 1 | D → N in BAE29439. Ref.2 | |||||||||||||||||
| Sequence conflict | 701 | 1 | P → T in BAE29439. Ref.2 | |||||||||||||||||
Secondary structure | ||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||
| Helix | 283 – 293 | 11 | ||||||||||||||||||
| Turn | 294 – 296 | 3 | ||||||||||||||||||
| Beta strand | 303 – 305 | 3 | ||||||||||||||||||
| Helix | 306 – 316 | 11 | ||||||||||||||||||
| Helix | 320 – 330 | 11 | ||||||||||||||||||
| Beta strand | 335 – 339 | 5 | ||||||||||||||||||
| Helix | 340 – 355 | 16 | ||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "An eps homology (EH) domain protein that binds to the ral-GTPase target, RalBP1." Yamaguchi A., Urano T., Goi T., Feig L.A. J. Biol. Chem. 272:31230-31234(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), CHARACTERIZATION. Tissue: Muscle. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 39-795 (ISOFORM 1). Strain: C57BL/6J. Tissue: Bone marrow and Thymus. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 499-795 (ISOFORM 1). Tissue: Embryo and Mammary tumor. |
| [5] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-272, MASS SPECTROMETRY. Tissue: Liver. |
| [6] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186 AND SER-708, MASS SPECTROMETRY. Tissue: Melanoma. |
| [7] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-561 AND SER-708, MASS SPECTROMETRY. Tissue: Macrophage. |
| [8] | "Solution structure of the Reps1 EH domain and characterization of its binding to NPF target sequences." Kim S., Cullis D.N., Feig L.A., Baleja J.D. Biochemistry 40:6776-6785(2001) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 279-370. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF031939 mRNA. Translation: AAB94736.1. AK150284 mRNA. Translation: BAE29439.1. Different initiation. AK151309 mRNA. Translation: BAE30291.1. Different initiation. AK041967 mRNA. Translation: BAC31117.1. AC153433 Genomic DNA. No translation available. BC002256 mRNA. No translation available. BC087547 mRNA. Translation: AAH87547.1. | ||||||||||||
| IPI | IPI00119795. IPI00338228. IPI00880345. IPI00918818. | ||||||||||||
| PIR | T09173. | ||||||||||||
| RefSeq | NP_001104535.1. NM_001111065.1. NP_033074.2. NM_009048.2. | ||||||||||||
| UniGene | Mm.4479. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O54916. | ||||||||||||
| SMR | O54916. Positions 279-370. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O54916. 2 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O54916. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O54916. | ||||||||||||
| PRIDE | O54916. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000126390; ENSMUSP00000123238; ENSMUSG00000019854. | ||||||||||||
| GeneID | 19707. | ||||||||||||
| KEGG | mmu:19707. | ||||||||||||
| UCSC | uc007ema.2. mouse. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 85021. | ||||||||||||
| MGI | MGI:1196373. Reps1. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG313227. | ||||||||||||
| GeneTree | ENSGT00530000063792. | ||||||||||||
| HOGENOM | HOG000231382. | ||||||||||||
| HOVERGEN | HBG056372. | ||||||||||||
| InParanoid | Q3UAM3. | ||||||||||||
| OMA | EQKYYSD. | ||||||||||||
| OrthoDB | EOG4Z36D5. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O54916. | ||||||||||||
| Bgee | O54916. | ||||||||||||
| CleanEx | MM_REPS1. | ||||||||||||
| Genevestigator | O54916. | ||||||||||||
| GermOnline | ENSMUSG00000019854. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.238.10. 2 hits. | ||||||||||||
| InterPro | IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR002048. EF_hand_dom. IPR000261. EPS15_homology. IPR026814. Reps. [Graphical view] | ||||||||||||
| PANTHER | PTHR11216:SF33. PTHR11216:SF33. 1 hit. | ||||||||||||
| SMART | SM00027. EH. 2 hits. [Graphical view] | ||||||||||||
| PROSITE | PS00018. EF_HAND_1. 1 hit. PS50222. EF_HAND_2. 1 hit. PS50031. EH. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | REPS1. mouse. | ||||||||||||
| EvolutionaryTrace | O54916. | ||||||||||||
| NextBio | 297082. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | REPS1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O54916 Secondary accession number(s): Q3UAM3 Q99LR8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
