Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O54819 (TFPI1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 129. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tissue factor pathway inhibitor

Short name=TFPI
Alternative name(s):
Extrinsic pathway inhibitor
Short name=EPI
Lipoprotein-associated coagulation inhibitor
Short name=LACI
Gene names
Name:Tfpi
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length306 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma By similarity.

Subcellular location

Secreted.

Tissue specificity

Isoform alphais expressed in heart and spleen; isoform betain heart and lung.

Domain

This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa By similarity.

Sequence similarities

Contains 3 BPTI/Kunitz inhibitor domains.

Ontologies

Keywords
   Biological processBlood coagulation
Hemostasis
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
   DomainRepeat
Signal
   Molecular functionProtease inhibitor
Serine protease inhibitor
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processblood coagulation

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentextracellular space

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionserine-type endopeptidase inhibitor activity

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform Alpha (identifier: O54819-1)

Also known as: TFPIalpha;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Beta (identifier: O54819-2)

Also known as: TFPIbeta;

The sequence of this isoform differs from the canonical sequence as follows:
     218-253: DYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRF → VTKEETNGGWKNADYTYQGFLSSVYIHVLYFVFRIG
     254-306: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2828 By similarity
Chain29 – 306278Tissue factor pathway inhibitor
PRO_0000016873

Regions

Domain50 – 10051BPTI/Kunitz inhibitor 1
Domain121 – 17151BPTI/Kunitz inhibitor 2
Domain225 – 27551BPTI/Kunitz inhibitor 3

Sites

Site60 – 612Reactive bond By similarity
Site131 – 1322Reactive bond By similarity
Site235 – 2362Reactive bond By similarity

Amino acid modifications

Glycosylation1411N-linked (GlcNAc...) Potential
Glycosylation2541N-linked (GlcNAc...) Potential
Glycosylation2641N-linked (GlcNAc...) Potential
Glycosylation2821N-linked (GlcNAc...) Potential
Disulfide bond50 ↔ 100 By similarity
Disulfide bond59 ↔ 83 By similarity
Disulfide bond75 ↔ 96 By similarity
Disulfide bond121 ↔ 171 By similarity
Disulfide bond130 ↔ 154 By similarity
Disulfide bond146 ↔ 167 By similarity
Disulfide bond225 ↔ 275 By similarity
Disulfide bond234 ↔ 258 By similarity
Disulfide bond250 ↔ 271 By similarity

Natural variations

Alternative sequence218 – 25336DYRGR…KCHRF → VTKEETNGGWKNADYTYQGF LSSVYIHVLYFVFRIG in isoform Beta.
VSP_003032
Alternative sequence254 – 30653Missing in isoform Beta.
VSP_003033

Experimental info

Sequence conflict681F → L in AAD01586. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform Alpha (TFPIalpha) [UniParc].

Last modified June 1, 1998. Version 1.
Checksum: D3EA3297E4B6A359

FASTA30634,987
        10         20         30         40         50         60 
MTYKMKKEYA FWATVCLLLS LVPEFLNALS EEADDTDSEL GSMKPLHTFC AMKADDGPCK 

        70         80         90        100        110        120 
AMIRSYFFNM YTHQCEEFIY GGCEGNENRF DTLEECKKTC IPGYEKTAVK AASGAERPDF 

       130        140        150        160        170        180 
CFLEEDPGLC RGYMKRYLYN NQTKQCERFV YGGCLGNRNN FETLDECKKI CENPVHSPSP 

       190        200        210        220        230        240 
VNEVQMSDYV TDGNTVTDRS TVNNIVVPQS PKVPRRRDYR GRPWCLQPAD SGLCKASERR 

       250        260        270        280        290        300 
FYYNSATGKC HRFNYTGCGG NNNNFTTRRR CLRSCKTGLI KNKSKGVVKI QRRKAPFVKV 


VYESIN 

« Hide

Isoform Beta (TFPIbeta) [UniParc].

Checksum: FDEAB02B634A810B
Show »

FASTA25328,949

References

« Hide 'large scale' references
[1]"Cloning, expression, and characterization of mouse tissue factor pathway inhibitor (TFPI)."
Chang J.-Y., Monroe D.M., Oliver J.A., Liles D.K., Roberts H.R.
Thromb. Haemost. 79:306-309(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
Strain: 129.
[2]"TFPIbeta, a second product from the mouse tissue factor pathway inhibitor (TFPI) gene."
Chang J.-Y., Monroe D.M., Oliver J.A., Roberts H.R.
Thromb. Haemost. 81:45-49(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA).
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
Strain: C57BL/6J.
Tissue: Placenta.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF004833 mRNA. Translation: AAC40035.1.
AF016313 mRNA. Translation: AAD01586.1.
AK028356 mRNA. Translation: BAC25901.1.
CCDSCCDS16185.1. [O54819-1]
RefSeqNP_035706.1. NM_011576.1. [O54819-1]
XP_006499208.1. XM_006499145.1. [O54819-1]
XP_006499209.1. XM_006499146.1. [O54819-1]
XP_006499210.1. XM_006499147.1. [O54819-1]
XP_006499211.1. XM_006499148.1. [O54819-1]
XP_006499212.1. XM_006499149.1. [O54819-2]
UniGeneMm.124316.
Mm.447013.

3D structure databases

ProteinModelPortalO54819.
SMRO54819. Positions 39-100, 120-173, 218-278.
ModBaseSearch...
MobiDBSearch...

Protein family/group databases

MEROPSI02.011.

PTM databases

PhosphoSiteO54819.

Proteomic databases

PaxDbO54819.
PRIDEO54819.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000028487; ENSMUSP00000028487; ENSMUSG00000027082. [O54819-1]
ENSMUST00000111718; ENSMUSP00000107347; ENSMUSG00000027082. [O54819-1]
GeneID21788.
KEGGmmu:21788.
UCSCuc008kij.1. mouse. [O54819-1]
uc008kim.1. mouse. [O54819-2]

Organism-specific databases

CTD7035.
MGIMGI:1095418. Tfpi.

Phylogenomic databases

eggNOGNOG86404.
GeneTreeENSGT00740000114929.
HOGENOMHOG000231818.
HOVERGENHBG056804.
InParanoidO54819.
KOK03909.
OMAFIQRISK.
OrthoDBEOG73FQKT.
PhylomeDBO54819.
TreeFamTF315349.

Gene expression databases

ArrayExpressO54819.
BgeeO54819.
CleanExMM_TFPI.
GenevestigatorO54819.

Family and domain databases

Gene3D4.10.410.10. 3 hits.
InterProIPR002223. Prot_inh_Kunz-m.
IPR008296. Prot_inhib_I2_TFPI.
IPR020901. Prtase_inh_Kunz-CS.
[Graphical view]
PfamPF00014. Kunitz_BPTI. 3 hits.
[Graphical view]
PIRSFPIRSF001620. TFPI. 1 hit.
PRINTSPR00759. BASICPTASE.
SMARTSM00131. KU. 3 hits.
[Graphical view]
SUPFAMSSF57362. SSF57362. 3 hits.
PROSITEPS00280. BPTI_KUNITZ_1. 3 hits.
PS50279. BPTI_KUNITZ_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio301144.
PROO54819.
SOURCESearch...

Entry information

Entry nameTFPI1_MOUSE
AccessionPrimary (citable) accession number: O54819
Secondary accession number(s): Q9Z2U8
Entry history
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: June 1, 1998
Last modified: July 9, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot