Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O54819

- TFPI1_MOUSE

UniProt

O54819 - TFPI1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tissue factor pathway inhibitor

Gene

Tfpi

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei60 – 612Reactive bondBy similarity
Sitei131 – 1322Reactive bondBy similarity
Sitei235 – 2362Reactive bondBy similarity

GO - Molecular functioni

  1. serine-type endopeptidase inhibitor activity Source: UniProtKB-KW

GO - Biological processi

  1. blood coagulation Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Protease inhibitor, Serine protease inhibitor

Keywords - Biological processi

Blood coagulation, Hemostasis

Protein family/group databases

MEROPSiI02.011.

Names & Taxonomyi

Protein namesi
Recommended name:
Tissue factor pathway inhibitor
Short name:
TFPI
Alternative name(s):
Extrinsic pathway inhibitor
Short name:
EPI
Lipoprotein-associated coagulation inhibitor
Short name:
LACI
Gene namesi
Name:Tfpi
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:1095418. Tfpi.

Subcellular locationi

GO - Cellular componenti

  1. extracellular space Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2828By similarityAdd
BLAST
Chaini29 – 306278Tissue factor pathway inhibitorPRO_0000016873Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi50 ↔ 100PROSITE-ProRule annotation
Disulfide bondi59 ↔ 83PROSITE-ProRule annotation
Disulfide bondi75 ↔ 96PROSITE-ProRule annotation
Disulfide bondi121 ↔ 171PROSITE-ProRule annotation
Disulfide bondi130 ↔ 154PROSITE-ProRule annotation
Glycosylationi141 – 1411N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi146 ↔ 167PROSITE-ProRule annotation
Disulfide bondi225 ↔ 275PROSITE-ProRule annotation
Disulfide bondi234 ↔ 258PROSITE-ProRule annotation
Disulfide bondi250 ↔ 271PROSITE-ProRule annotation
Glycosylationi254 – 2541N-linked (GlcNAc...)Sequence Analysis
Glycosylationi264 – 2641N-linked (GlcNAc...)Sequence Analysis
Glycosylationi282 – 2821N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO54819.
PRIDEiO54819.

PTM databases

PhosphoSiteiO54819.

Expressioni

Tissue specificityi

Isoform alpha is expressed in heart and spleen; isoform beta in heart and lung.

Gene expression databases

BgeeiO54819.
CleanExiMM_TFPI.
ExpressionAtlasiO54819. baseline and differential.
GenevestigatoriO54819.

Structurei

3D structure databases

ProteinModelPortaliO54819.
SMRiO54819. Positions 39-100, 120-173, 218-278.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini50 – 10051BPTI/Kunitz inhibitor 1PROSITE-ProRule annotationAdd
BLAST
Domaini121 – 17151BPTI/Kunitz inhibitor 2PROSITE-ProRule annotationAdd
BLAST
Domaini225 – 27551BPTI/Kunitz inhibitor 3PROSITE-ProRule annotationAdd
BLAST

Domaini

This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa (By similarity).By similarity

Sequence similaritiesi

Contains 3 BPTI/Kunitz inhibitor domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiNOG86404.
GeneTreeiENSGT00740000114929.
HOGENOMiHOG000231818.
HOVERGENiHBG056804.
InParanoidiO54819.
KOiK03909.
OMAiFIQRISK.
OrthoDBiEOG73FQKT.
PhylomeDBiO54819.
TreeFamiTF315349.

Family and domain databases

Gene3Di4.10.410.10. 3 hits.
InterProiIPR002223. Prot_inh_Kunz-m.
IPR008296. Prot_inhib_I2_TFPI.
IPR020901. Prtase_inh_Kunz-CS.
[Graphical view]
PfamiPF00014. Kunitz_BPTI. 3 hits.
[Graphical view]
PIRSFiPIRSF001620. TFPI. 1 hit.
PRINTSiPR00759. BASICPTASE.
SMARTiSM00131. KU. 3 hits.
[Graphical view]
SUPFAMiSSF57362. SSF57362. 3 hits.
PROSITEiPS00280. BPTI_KUNITZ_1. 3 hits.
PS50279. BPTI_KUNITZ_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Alpha (identifier: O54819-1) [UniParc]FASTAAdd to Basket

Also known as: TFPIalpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTYKMKKEYA FWATVCLLLS LVPEFLNALS EEADDTDSEL GSMKPLHTFC
60 70 80 90 100
AMKADDGPCK AMIRSYFFNM YTHQCEEFIY GGCEGNENRF DTLEECKKTC
110 120 130 140 150
IPGYEKTAVK AASGAERPDF CFLEEDPGLC RGYMKRYLYN NQTKQCERFV
160 170 180 190 200
YGGCLGNRNN FETLDECKKI CENPVHSPSP VNEVQMSDYV TDGNTVTDRS
210 220 230 240 250
TVNNIVVPQS PKVPRRRDYR GRPWCLQPAD SGLCKASERR FYYNSATGKC
260 270 280 290 300
HRFNYTGCGG NNNNFTTRRR CLRSCKTGLI KNKSKGVVKI QRRKAPFVKV

VYESIN
Length:306
Mass (Da):34,987
Last modified:June 1, 1998 - v1
Checksum:iD3EA3297E4B6A359
GO
Isoform Beta (identifier: O54819-2) [UniParc]FASTAAdd to Basket

Also known as: TFPIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     218-253: DYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRF → VTKEETNGGWKNADYTYQGFLSSVYIHVLYFVFRIG
     254-306: Missing.

Show »
Length:253
Mass (Da):28,949
Checksum:iFDEAB02B634A810B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti68 – 681F → L in AAD01586. (PubMed:9974373)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei218 – 25336DYRGR…KCHRF → VTKEETNGGWKNADYTYQGF LSSVYIHVLYFVFRIG in isoform Beta. 1 PublicationVSP_003032Add
BLAST
Alternative sequencei254 – 30653Missing in isoform Beta. 1 PublicationVSP_003033Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF004833 mRNA. Translation: AAC40035.1.
AF016313 mRNA. Translation: AAD01586.1.
AK028356 mRNA. Translation: BAC25901.1.
CCDSiCCDS16185.1. [O54819-1]
RefSeqiNP_035706.1. NM_011576.1. [O54819-1]
XP_006499208.1. XM_006499145.1. [O54819-1]
XP_006499209.1. XM_006499146.1. [O54819-1]
XP_006499210.1. XM_006499147.1. [O54819-1]
XP_006499211.1. XM_006499148.1. [O54819-1]
XP_006499212.1. XM_006499149.1. [O54819-2]
UniGeneiMm.124316.
Mm.447013.

Genome annotation databases

EnsembliENSMUST00000028487; ENSMUSP00000028487; ENSMUSG00000027082. [O54819-1]
ENSMUST00000111718; ENSMUSP00000107347; ENSMUSG00000027082. [O54819-1]
GeneIDi21788.
KEGGimmu:21788.
UCSCiuc008kij.1. mouse. [O54819-1]
uc008kim.1. mouse. [O54819-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF004833 mRNA. Translation: AAC40035.1 .
AF016313 mRNA. Translation: AAD01586.1 .
AK028356 mRNA. Translation: BAC25901.1 .
CCDSi CCDS16185.1. [O54819-1 ]
RefSeqi NP_035706.1. NM_011576.1. [O54819-1 ]
XP_006499208.1. XM_006499145.1. [O54819-1 ]
XP_006499209.1. XM_006499146.1. [O54819-1 ]
XP_006499210.1. XM_006499147.1. [O54819-1 ]
XP_006499211.1. XM_006499148.1. [O54819-1 ]
XP_006499212.1. XM_006499149.1. [O54819-2 ]
UniGenei Mm.124316.
Mm.447013.

3D structure databases

ProteinModelPortali O54819.
SMRi O54819. Positions 39-100, 120-173, 218-278.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

MEROPSi I02.011.

PTM databases

PhosphoSitei O54819.

Proteomic databases

PaxDbi O54819.
PRIDEi O54819.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000028487 ; ENSMUSP00000028487 ; ENSMUSG00000027082 . [O54819-1 ]
ENSMUST00000111718 ; ENSMUSP00000107347 ; ENSMUSG00000027082 . [O54819-1 ]
GeneIDi 21788.
KEGGi mmu:21788.
UCSCi uc008kij.1. mouse. [O54819-1 ]
uc008kim.1. mouse. [O54819-2 ]

Organism-specific databases

CTDi 7035.
MGIi MGI:1095418. Tfpi.

Phylogenomic databases

eggNOGi NOG86404.
GeneTreei ENSGT00740000114929.
HOGENOMi HOG000231818.
HOVERGENi HBG056804.
InParanoidi O54819.
KOi K03909.
OMAi FIQRISK.
OrthoDBi EOG73FQKT.
PhylomeDBi O54819.
TreeFami TF315349.

Miscellaneous databases

NextBioi 301144.
PROi O54819.
SOURCEi Search...

Gene expression databases

Bgeei O54819.
CleanExi MM_TFPI.
ExpressionAtlasi O54819. baseline and differential.
Genevestigatori O54819.

Family and domain databases

Gene3Di 4.10.410.10. 3 hits.
InterProi IPR002223. Prot_inh_Kunz-m.
IPR008296. Prot_inhib_I2_TFPI.
IPR020901. Prtase_inh_Kunz-CS.
[Graphical view ]
Pfami PF00014. Kunitz_BPTI. 3 hits.
[Graphical view ]
PIRSFi PIRSF001620. TFPI. 1 hit.
PRINTSi PR00759. BASICPTASE.
SMARTi SM00131. KU. 3 hits.
[Graphical view ]
SUPFAMi SSF57362. SSF57362. 3 hits.
PROSITEi PS00280. BPTI_KUNITZ_1. 3 hits.
PS50279. BPTI_KUNITZ_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, expression, and characterization of mouse tissue factor pathway inhibitor (TFPI)."
    Chang J.-Y., Monroe D.M., Oliver J.A., Liles D.K., Roberts H.R.
    Thromb. Haemost. 79:306-309(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
    Strain: 129.
  2. "TFPIbeta, a second product from the mouse tissue factor pathway inhibitor (TFPI) gene."
    Chang J.-Y., Monroe D.M., Oliver J.A., Roberts H.R.
    Thromb. Haemost. 81:45-49(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA).
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
    Strain: C57BL/6J.
    Tissue: Placenta.

Entry informationi

Entry nameiTFPI1_MOUSE
AccessioniPrimary (citable) accession number: O54819
Secondary accession number(s): Q9Z2U8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: June 1, 1998
Last modified: October 29, 2014
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3