Reviewed,
UniProtKB/Swiss-Prot O54819 (TFPI1_MOUSE)
Last modified
June 16, 2009.
Version 84.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Tissue factor pathway inhibitor Short name=TFPI Alternative name(s): Lipoprotein-associated coagulation inhibitor Short name=LACI Extrinsic pathway inhibitor Short name=EPI | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 306 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma By similarity. |
| Subcellular location | |
| Tissue specificity | Isoform alpha is expressed in heart and spleen; isoform beta in heart and lung. |
| Domain | This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa By similarity. |
| Sequence similarities | Contains 3 BPTI/Kunitz inhibitor domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Blood coagulation |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal |
| Molecular function | Protease inhibitor Serine protease inhibitor |
| PTM | Disulfide bond Glycoprotein |
| Gene Ontology (GO) | |
| Biological process | blood coagulation Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | serine-type endopeptidase inhibitor activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha (identifier: O54819-1) Also known as: TFPIalpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta (identifier: O54819-2) Also known as: TFPIbeta; The sequence of this isoform differs from the canonical sequence as follows: 218-253: DYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRF → VTKEETNGGWKNADYTYQGFLSSVYIHVLYFVFRIG 254-306: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 28 | 28 | By similarity | ||||||||
| Chain | 29 – 306 | 278 | Tissue factor pathway inhibitor | PRO_0000016873 | |||||||
Regions | |||||||||||
| Domain | 50 – 100 | 51 | BPTI/Kunitz inhibitor 1 | ||||||||
| Domain | 121 – 171 | 51 | BPTI/Kunitz inhibitor 2 | ||||||||
| Domain | 225 – 275 | 51 | BPTI/Kunitz inhibitor 3 | ||||||||
Sites | |||||||||||
| Site | 60 – 61 | 2 | Reactive bond By similarity | ||||||||
| Site | 131 – 132 | 2 | Reactive bond By similarity | ||||||||
| Site | 235 – 236 | 2 | Reactive bond By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 141 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 254 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 264 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 282 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 50 ↔ 100 | By similarity | |||||||||
| Disulfide bond | 59 ↔ 83 | By similarity | |||||||||
| Disulfide bond | 75 ↔ 96 | By similarity | |||||||||
| Disulfide bond | 121 ↔ 171 | By similarity | |||||||||
| Disulfide bond | 130 ↔ 154 | By similarity | |||||||||
| Disulfide bond | 146 ↔ 167 | By similarity | |||||||||
| Disulfide bond | 225 ↔ 275 | By similarity | |||||||||
| Disulfide bond | 234 ↔ 258 | By similarity | |||||||||
| Disulfide bond | 250 ↔ 271 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 218 – 253 | 36 | DYRGR…KCHRF → VTKEETNGGWKNADYTYQGF LSSVYIHVLYFVFRIG in isoform Beta. | VSP_003032 | |||||||
| Alternative sequence | 254 – 306 | 53 | Missing in isoform Beta. | VSP_003033 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 68 | 1 | F → L in AAD01586. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, expression, and characterization of mouse tissue factor pathway inhibitor (TFPI)." Chang J.-Y., Monroe D.M., Oliver J.A., Liles D.K., Roberts H.R. Thromb. Haemost. 79:306-309(1998) [PubMed: 9493581] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). Strain: 129. |
| [2] | "TFPIbeta, a second product from the mouse tissue factor pathway inhibitor (TFPI) gene." Chang J.-Y., Monroe D.M., Oliver J.A., Roberts H.R. Thromb. Haemost. 81:45-49(1999) [PubMed: 9974373] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA). |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Strain: C57BL/6J. Tissue: Placenta. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF004833 mRNA. Translation: AAC40035.1. AF016313 mRNA. Translation: AAD01586.1. AK028356 mRNA. Translation: BAC25901.1. | |
| IPI | IPI00118737. IPI00229887. |
| RefSeq | NP_035706.1. |
| UniGene | Mm.124316 Mm.447013 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1TFX based on UniProtKB P10646. |
| SMR | O54819. Positions 117-173. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | O54819. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000027082. Mus musculus. [Contig view] |
| GeneID | 21788. |
| KEGG | mmu:21788. |
Organism-specific databases | |
| MGI | MGI:1095418. Tfpi. |
Phylogenomic databases | |
| HOGENOM | O54819. |
| HOVERGEN | O54819. |
| OMA | O54819. FIQRISK. |
Gene expression databases | |
| ArrayExpress | O54819. |
| Bgee | O54819. |
| CleanEx | MM_TFPI. |
| GermOnline | ENSMUSG00000027082. Mus musculus. |
Family and domain databases | |
| InterPro | IPR002223. Prot_inh_Kunz-m. IPR008296. Prot_inhib_I2_TFPI. [Graphical view] |
| Gene3D | G3DSA:4.10.410.10. Prot_inh_Kunz-m. 2 hits. |
| Pfam | PF00014. Kunitz_BPTI. 3 hits. [Graphical view] |
| PIRSF | PIRSF001620. TFPI. 1 hit. |
| ProDom | PD000222. Prot_Inh_Kunz-m. 3 hits. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00131. KU. 3 hits. [Graphical view] |
| PROSITE | PS00280. BPTI_KUNITZ_1. 3 hits. PS50279. BPTI_KUNITZ_2. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 301144. |
| SOURCE | Search... |
Entry information
| Entry name | TFPI1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O54819 Secondary accession number(s): Q9Z2U8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


