Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O54819

- TFPI1_MOUSE

UniProt

O54819 - TFPI1_MOUSE

Protein

Tissue factor pathway inhibitor

Gene

Tfpi

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 1 (01 Jun 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei60 – 612Reactive bondBy similarity
    Sitei131 – 1322Reactive bondBy similarity
    Sitei235 – 2362Reactive bondBy similarity

    GO - Molecular functioni

    1. serine-type endopeptidase inhibitor activity Source: UniProtKB-KW

    GO - Biological processi

    1. blood coagulation Source: UniProtKB-KW

    Keywords - Molecular functioni

    Protease inhibitor, Serine protease inhibitor

    Keywords - Biological processi

    Blood coagulation, Hemostasis

    Protein family/group databases

    MEROPSiI02.011.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tissue factor pathway inhibitor
    Short name:
    TFPI
    Alternative name(s):
    Extrinsic pathway inhibitor
    Short name:
    EPI
    Lipoprotein-associated coagulation inhibitor
    Short name:
    LACI
    Gene namesi
    Name:Tfpi
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:1095418. Tfpi.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular space Source: Ensembl

    Keywords - Cellular componenti

    Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2828By similarityAdd
    BLAST
    Chaini29 – 306278Tissue factor pathway inhibitorPRO_0000016873Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi50 ↔ 100PROSITE-ProRule annotation
    Disulfide bondi59 ↔ 83PROSITE-ProRule annotation
    Disulfide bondi75 ↔ 96PROSITE-ProRule annotation
    Disulfide bondi121 ↔ 171PROSITE-ProRule annotation
    Disulfide bondi130 ↔ 154PROSITE-ProRule annotation
    Glycosylationi141 – 1411N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi146 ↔ 167PROSITE-ProRule annotation
    Disulfide bondi225 ↔ 275PROSITE-ProRule annotation
    Disulfide bondi234 ↔ 258PROSITE-ProRule annotation
    Disulfide bondi250 ↔ 271PROSITE-ProRule annotation
    Glycosylationi254 – 2541N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi264 – 2641N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi282 – 2821N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiO54819.
    PRIDEiO54819.

    PTM databases

    PhosphoSiteiO54819.

    Expressioni

    Tissue specificityi

    Isoform alpha is expressed in heart and spleen; isoform beta in heart and lung.

    Gene expression databases

    ArrayExpressiO54819.
    BgeeiO54819.
    CleanExiMM_TFPI.
    GenevestigatoriO54819.

    Structurei

    3D structure databases

    ProteinModelPortaliO54819.
    SMRiO54819. Positions 39-100, 120-173, 218-278.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini50 – 10051BPTI/Kunitz inhibitor 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini121 – 17151BPTI/Kunitz inhibitor 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini225 – 27551BPTI/Kunitz inhibitor 3PROSITE-ProRule annotationAdd
    BLAST

    Domaini

    This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa By similarity.By similarity

    Sequence similaritiesi

    Contains 3 BPTI/Kunitz inhibitor domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal

    Phylogenomic databases

    eggNOGiNOG86404.
    GeneTreeiENSGT00740000114929.
    HOGENOMiHOG000231818.
    HOVERGENiHBG056804.
    InParanoidiO54819.
    KOiK03909.
    OMAiFIQRISK.
    OrthoDBiEOG73FQKT.
    PhylomeDBiO54819.
    TreeFamiTF315349.

    Family and domain databases

    Gene3Di4.10.410.10. 3 hits.
    InterProiIPR002223. Prot_inh_Kunz-m.
    IPR008296. Prot_inhib_I2_TFPI.
    IPR020901. Prtase_inh_Kunz-CS.
    [Graphical view]
    PfamiPF00014. Kunitz_BPTI. 3 hits.
    [Graphical view]
    PIRSFiPIRSF001620. TFPI. 1 hit.
    PRINTSiPR00759. BASICPTASE.
    SMARTiSM00131. KU. 3 hits.
    [Graphical view]
    SUPFAMiSSF57362. SSF57362. 3 hits.
    PROSITEiPS00280. BPTI_KUNITZ_1. 3 hits.
    PS50279. BPTI_KUNITZ_2. 3 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform Alpha (identifier: O54819-1) [UniParc]FASTAAdd to Basket

    Also known as: TFPIalpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTYKMKKEYA FWATVCLLLS LVPEFLNALS EEADDTDSEL GSMKPLHTFC    50
    AMKADDGPCK AMIRSYFFNM YTHQCEEFIY GGCEGNENRF DTLEECKKTC 100
    IPGYEKTAVK AASGAERPDF CFLEEDPGLC RGYMKRYLYN NQTKQCERFV 150
    YGGCLGNRNN FETLDECKKI CENPVHSPSP VNEVQMSDYV TDGNTVTDRS 200
    TVNNIVVPQS PKVPRRRDYR GRPWCLQPAD SGLCKASERR FYYNSATGKC 250
    HRFNYTGCGG NNNNFTTRRR CLRSCKTGLI KNKSKGVVKI QRRKAPFVKV 300
    VYESIN 306
    Length:306
    Mass (Da):34,987
    Last modified:June 1, 1998 - v1
    Checksum:iD3EA3297E4B6A359
    GO
    Isoform Beta (identifier: O54819-2) [UniParc]FASTAAdd to Basket

    Also known as: TFPIbeta

    The sequence of this isoform differs from the canonical sequence as follows:
         218-253: DYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRF → VTKEETNGGWKNADYTYQGFLSSVYIHVLYFVFRIG
         254-306: Missing.

    Show »
    Length:253
    Mass (Da):28,949
    Checksum:iFDEAB02B634A810B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti68 – 681F → L in AAD01586. (PubMed:9974373)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei218 – 25336DYRGR…KCHRF → VTKEETNGGWKNADYTYQGF LSSVYIHVLYFVFRIG in isoform Beta. 1 PublicationVSP_003032Add
    BLAST
    Alternative sequencei254 – 30653Missing in isoform Beta. 1 PublicationVSP_003033Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF004833 mRNA. Translation: AAC40035.1.
    AF016313 mRNA. Translation: AAD01586.1.
    AK028356 mRNA. Translation: BAC25901.1.
    CCDSiCCDS16185.1. [O54819-1]
    RefSeqiNP_035706.1. NM_011576.1. [O54819-1]
    XP_006499208.1. XM_006499145.1. [O54819-1]
    XP_006499209.1. XM_006499146.1. [O54819-1]
    XP_006499210.1. XM_006499147.1. [O54819-1]
    XP_006499211.1. XM_006499148.1. [O54819-1]
    XP_006499212.1. XM_006499149.1. [O54819-2]
    UniGeneiMm.124316.
    Mm.447013.

    Genome annotation databases

    EnsembliENSMUST00000028487; ENSMUSP00000028487; ENSMUSG00000027082. [O54819-1]
    ENSMUST00000111718; ENSMUSP00000107347; ENSMUSG00000027082. [O54819-1]
    GeneIDi21788.
    KEGGimmu:21788.
    UCSCiuc008kij.1. mouse. [O54819-1]
    uc008kim.1. mouse. [O54819-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF004833 mRNA. Translation: AAC40035.1 .
    AF016313 mRNA. Translation: AAD01586.1 .
    AK028356 mRNA. Translation: BAC25901.1 .
    CCDSi CCDS16185.1. [O54819-1 ]
    RefSeqi NP_035706.1. NM_011576.1. [O54819-1 ]
    XP_006499208.1. XM_006499145.1. [O54819-1 ]
    XP_006499209.1. XM_006499146.1. [O54819-1 ]
    XP_006499210.1. XM_006499147.1. [O54819-1 ]
    XP_006499211.1. XM_006499148.1. [O54819-1 ]
    XP_006499212.1. XM_006499149.1. [O54819-2 ]
    UniGenei Mm.124316.
    Mm.447013.

    3D structure databases

    ProteinModelPortali O54819.
    SMRi O54819. Positions 39-100, 120-173, 218-278.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    MEROPSi I02.011.

    PTM databases

    PhosphoSitei O54819.

    Proteomic databases

    PaxDbi O54819.
    PRIDEi O54819.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000028487 ; ENSMUSP00000028487 ; ENSMUSG00000027082 . [O54819-1 ]
    ENSMUST00000111718 ; ENSMUSP00000107347 ; ENSMUSG00000027082 . [O54819-1 ]
    GeneIDi 21788.
    KEGGi mmu:21788.
    UCSCi uc008kij.1. mouse. [O54819-1 ]
    uc008kim.1. mouse. [O54819-2 ]

    Organism-specific databases

    CTDi 7035.
    MGIi MGI:1095418. Tfpi.

    Phylogenomic databases

    eggNOGi NOG86404.
    GeneTreei ENSGT00740000114929.
    HOGENOMi HOG000231818.
    HOVERGENi HBG056804.
    InParanoidi O54819.
    KOi K03909.
    OMAi FIQRISK.
    OrthoDBi EOG73FQKT.
    PhylomeDBi O54819.
    TreeFami TF315349.

    Miscellaneous databases

    NextBioi 301144.
    PROi O54819.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O54819.
    Bgeei O54819.
    CleanExi MM_TFPI.
    Genevestigatori O54819.

    Family and domain databases

    Gene3Di 4.10.410.10. 3 hits.
    InterProi IPR002223. Prot_inh_Kunz-m.
    IPR008296. Prot_inhib_I2_TFPI.
    IPR020901. Prtase_inh_Kunz-CS.
    [Graphical view ]
    Pfami PF00014. Kunitz_BPTI. 3 hits.
    [Graphical view ]
    PIRSFi PIRSF001620. TFPI. 1 hit.
    PRINTSi PR00759. BASICPTASE.
    SMARTi SM00131. KU. 3 hits.
    [Graphical view ]
    SUPFAMi SSF57362. SSF57362. 3 hits.
    PROSITEi PS00280. BPTI_KUNITZ_1. 3 hits.
    PS50279. BPTI_KUNITZ_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, expression, and characterization of mouse tissue factor pathway inhibitor (TFPI)."
      Chang J.-Y., Monroe D.M., Oliver J.A., Liles D.K., Roberts H.R.
      Thromb. Haemost. 79:306-309(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
      Strain: 129.
    2. "TFPIbeta, a second product from the mouse tissue factor pathway inhibitor (TFPI) gene."
      Chang J.-Y., Monroe D.M., Oliver J.A., Roberts H.R.
      Thromb. Haemost. 81:45-49(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA).
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
      Strain: C57BL/6J.
      Tissue: Placenta.

    Entry informationi

    Entry nameiTFPI1_MOUSE
    AccessioniPrimary (citable) accession number: O54819
    Secondary accession number(s): Q9Z2U8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 21, 2001
    Last sequence update: June 1, 1998
    Last modified: October 1, 2014
    This is version 130 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3