Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM domain kinase 2

Gene

Limk2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.By similarity

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei360 – 3601ATPPROSITE-ProRule annotation
Active sitei451 – 4511By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi337 – 3459ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. protein heterodimerization activity Source: MGI
  3. protein kinase activity Source: MGI
  4. protein serine/threonine kinase activity Source: UniProtKB-KW
  5. zinc ion binding Source: InterPro

GO - Biological processi

  1. protein phosphorylation Source: MGI
  2. spermatogenesis Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain kinase 2 (EC:2.7.11.1)
Short name:
LIMK-2
Gene namesi
Name:Limk2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:1197517. Limk2.

Subcellular locationi

GO - Cellular componenti

  1. cis-Golgi network Source: MGI
  2. cytoplasm Source: MGI
  3. nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 638638LIM domain kinase 2PRO_0000075810Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei210 – 2101PhosphothreonineBy similarity
Modified residuei293 – 2931PhosphoserineBy similarity
Modified residuei298 – 2981PhosphoserineBy similarity
Modified residuei505 – 5051Phosphothreonine; by ROCK1 and CDC42BPBy similarity

Post-translational modificationi

Phosphorylated on serine and/or threonine residues by ROCK1.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO54785.
PRIDEiO54785.

PTM databases

PhosphoSiteiO54785.

Expressioni

Tissue specificityi

Isoform 3 is testis specific.

Gene expression databases

BgeeiO54785.
CleanExiMM_LIMK2.
ExpressionAtlasiO54785. baseline and differential.
GenevestigatoriO54785.

Interactioni

Subunit structurei

Binds ROCK1 and LKAP. Interacts with PARD3 (By similarity). Interacts with NISCH.By similarity1 Publication

Protein-protein interaction databases

BioGridi201167. 2 interactions.

Structurei

Secondary structure

1
638
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi149 – 1557Combined sources
Beta strandi159 – 1624Combined sources
Beta strandi164 – 1707Combined sources
Beta strandi174 – 1763Combined sources
Beta strandi179 – 1846Combined sources
Turni187 – 1893Combined sources
Helixi194 – 1974Combined sources
Beta strandi204 – 2118Combined sources
Turni212 – 2143Combined sources
Helixi217 – 2259Combined sources
Beta strandi231 – 2377Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2YUBNMR-A142-246[»]
ProteinModelPortaliO54785.
SMRiO54785. Positions 12-132, 139-246, 276-623.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO54785.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini12 – 6352LIM zinc-binding 1PROSITE-ProRule annotationAdd
BLAST
Domaini72 – 12453LIM zinc-binding 2PROSITE-ProRule annotationAdd
BLAST
Domaini152 – 23988PDZPROSITE-ProRule annotationAdd
BLAST
Domaini331 – 608278Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00530000063025.
HOGENOMiHOG000013121.
HOVERGENiHBG052328.
InParanoidiO54785.
KOiK05744.
OMAiDARLSPH.
OrthoDBiEOG73V6JQ.
PhylomeDBiO54785.
TreeFamiTF318014.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
PF00595. PDZ. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS50106. PDZ. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O54785-1) [UniParc]FASTAAdd to basket

Also known as: LIMK2a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAALAGDEAW RCRGCGTYVP LSQRLYRTAN EAWHGSCFRC SECQESLTNW
60 70 80 90 100
YYEKDGKLYC HKDYWAKFGE FCHGCSLLMT GPAMVAGEFK YHPECFACMS
110 120 130 140 150
CKVIIEDGDA YALVQHATLY CGKCHNEVVL APMFERLSTE SVQDQLPYSV
160 170 180 190 200
TLISMPATTE CRRGFSVTVE SASSNYATTV QVKEVNRMHI SPNNRNAIHP
210 220 230 240 250
GDRILEINGT PVRTLRVEEV EDAIKQTSQT LQLLIEHDPV PQRLDQLRLD
260 270 280 290 300
ARLPPHMQST GHTLMLSTLD TKENQEGTLR RRSLRRSNSI SKSPGPSSPK
310 320 330 340 350
EPLLLSRDIS RSESLRCSSS YSQQIFRPCD LIHGEVLGKG FFGQAIKVTH
360 370 380 390 400
KATGKVMVMK ELIRCDEETQ KTFLTEVKVM RSLDHPNVLK FIGVLYKDKK
410 420 430 440 450
LNLLTEYIEG GTLKDFLRSV DPFPWQQKVR FAKGISSGMA YLHSMCIIHR
460 470 480 490 500
DLNSHNCLIK LDKTVVVADF GLSRLIVEER KRPPVEKATT KKRTLRKSDR
510 520 530 540 550
KKRYTVVGNP YWMAPEMLNG KSYDETVDVF SFGIVLCEII GQVYADPDCL
560 570 580 590 600
PRTLDFGLNV KLFWEKFVPT DCPPAFFPLA AICCKLEPES RPAFSKLEDS
610 620 630
FEALSLFLGE LAIPLPAELE DLDHTVSMEY GLTRDSPP
Length:638
Mass (Da):72,202
Last modified:August 1, 1998 - v2
Checksum:i54CFA5E7A6A79C39
GO
Isoform 2 (identifier: O54785-2) [UniParc]FASTAAdd to basket

Also known as: LIMK2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MAALAGDEAWRCRGCGTYVPLSQRLYRTANEAWHGSC → MGSYLSVPAYFTSRDP

Show »
Length:617
Mass (Da):69,891
Checksum:i1E2DCE61958B8D0B
GO
Isoform 3 (identifier: O54785-3) [UniParc]FASTAAdd to basket

Also known as: LIMK2t, tLIMK2

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Show »
Length:451
Mass (Da):51,173
Checksum:i883063D71E077C2B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 187187Missing in isoform 3. 2 PublicationsVSP_010351Add
BLAST
Alternative sequencei1 – 3737MAALA…WHGSC → MGSYLSVPAYFTSRDP in isoform 2. 1 PublicationVSP_010350Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB008117 mRNA. Translation: BAA29035.1.
AB005140 Genomic DNA. Translation: BAA24491.1.
AB005131 mRNA. Translation: BAA24488.1.
AB005132 mRNA. Translation: BAA24489.1.
AB005134 Genomic DNA. Translation: BAA24490.1.
U88618 mRNA. Translation: AAC39947.1.
AB012291 mRNA. Translation: BAA32437.1.
AB012092 mRNA. Translation: BAA31147.1.
BC007129 mRNA. Translation: AAH07129.1.
CCDSiCCDS24358.1. [O54785-1]
CCDS24359.1. [O54785-2]
CCDS24360.1. [O54785-3]
PIRiJC5813.
JC5814.
JE0240.
RefSeqiNP_001029202.1. NM_001034030.2. [O54785-3]
NP_034848.1. NM_010718.4. [O54785-1]
NP_774958.1. NM_173053.1. [O54785-2]
UniGeneiMm.124176.
Mm.390323.
Mm.442189.

Genome annotation databases

EnsembliENSMUST00000101638; ENSMUSP00000099162; ENSMUSG00000020451. [O54785-1]
ENSMUST00000101642; ENSMUSP00000099165; ENSMUSG00000020451. [O54785-2]
ENSMUST00000110029; ENSMUSP00000105656; ENSMUSG00000020451. [O54785-3]
GeneIDi16886.
KEGGimmu:16886.
UCSCiuc007hss.1. mouse. [O54785-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB008117 mRNA. Translation: BAA29035.1.
AB005140 Genomic DNA. Translation: BAA24491.1.
AB005131 mRNA. Translation: BAA24488.1.
AB005132 mRNA. Translation: BAA24489.1.
AB005134 Genomic DNA. Translation: BAA24490.1.
U88618 mRNA. Translation: AAC39947.1.
AB012291 mRNA. Translation: BAA32437.1.
AB012092 mRNA. Translation: BAA31147.1.
BC007129 mRNA. Translation: AAH07129.1.
CCDSiCCDS24358.1. [O54785-1]
CCDS24359.1. [O54785-2]
CCDS24360.1. [O54785-3]
PIRiJC5813.
JC5814.
JE0240.
RefSeqiNP_001029202.1. NM_001034030.2. [O54785-3]
NP_034848.1. NM_010718.4. [O54785-1]
NP_774958.1. NM_173053.1. [O54785-2]
UniGeneiMm.124176.
Mm.390323.
Mm.442189.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2YUBNMR-A142-246[»]
ProteinModelPortaliO54785.
SMRiO54785. Positions 12-132, 139-246, 276-623.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201167. 2 interactions.

PTM databases

PhosphoSiteiO54785.

Proteomic databases

MaxQBiO54785.
PRIDEiO54785.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000101638; ENSMUSP00000099162; ENSMUSG00000020451. [O54785-1]
ENSMUST00000101642; ENSMUSP00000099165; ENSMUSG00000020451. [O54785-2]
ENSMUST00000110029; ENSMUSP00000105656; ENSMUSG00000020451. [O54785-3]
GeneIDi16886.
KEGGimmu:16886.
UCSCiuc007hss.1. mouse. [O54785-1]

Organism-specific databases

CTDi3985.
MGIiMGI:1197517. Limk2.

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00530000063025.
HOGENOMiHOG000013121.
HOVERGENiHBG052328.
InParanoidiO54785.
KOiK05744.
OMAiDARLSPH.
OrthoDBiEOG73V6JQ.
PhylomeDBiO54785.
TreeFamiTF318014.

Miscellaneous databases

EvolutionaryTraceiO54785.
NextBioi290896.
PROiO54785.
SOURCEiSearch...

Gene expression databases

BgeeiO54785.
CleanExiMM_LIMK2.
ExpressionAtlasiO54785. baseline and differential.
GenevestigatoriO54785.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
PF00595. PDZ. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS50106. PDZ. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA cloning, genomic organization, and chromosomal localization of the mouse LIM motif-containing kinase gene, Limk2."
    Koshimizu U., Takahashi H., Yoshida M.C., Nakamura T.
    Biochem. Biophys. Res. Commun. 241:243-250(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: ICR.
    Tissue: Embryo.
  2. "Mouse LIM-kinase 2 gene: cDNA cloning, genomic organization, and tissue-specific expression of two alternatively initiated transcripts."
    Ikebe C., Ohashi K., Fujimori T., Bernard O., Noda T., Robertson E.J., Mizuno K.
    Genomics 46:504-508(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2).
    Strain: 129/Sv.
    Tissue: Kidney.
  3. "A novel transcript encoding truncated LIM kinase 2 is specifically expressed in male germ cells undergoing meiosis."
    Takahashi H., Koshimizu U., Nakamura T.
    Biochem. Biophys. Res. Commun. 249:138-145(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Testis.
  4. "Identification of testis-specific (LimK2t) and brain-specific (LimK2c) isoforms of mouse LIM-kinase 2 gene transcripts."
    Ikebe C., Ohashi K., Mizuno K.
    Biochem. Biophys. Res. Commun. 246:307-312(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Testis.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Mammary tumor.
  6. "Nischarin inhibits LIM kinase to regulate cofilin phosphorylation and cell invasion."
    Ding Y., Milosavljevic T., Alahari S.K.
    Mol. Cell. Biol. 28:3742-3756(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NISCH.
  7. "Solution structure of the PDZ domain from mouse LIM domain kinase."
    RIKEN structural genomics initiative (RSGI)
    Submitted (APR-2008) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 139-246.

Entry informationi

Entry nameiLIMK2_MOUSE
AccessioniPrimary (citable) accession number: O54785
Secondary accession number(s): O54776, O55238, Q9QUL4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: August 1, 1998
Last modified: March 4, 2015
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.