O54785 (LIMK2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LIM domain kinase 2 Short name=LIMK-2 EC=2.7.11.1 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 638 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro By similarity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subunit structure | Binds ROCK1 and LKAP. Interacts with PARD3 By similarity. Interacts with NISCH. Ref.6 |
| Subcellular location | |
| Tissue specificity | Isoform 3 is testis specific. |
| Post-translational modification | Phosphorylated on serine and/or threonine residues by ROCK1 By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Contains 2 LIM zinc-binding domains. Contains 1 PDZ (DHR) domain. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | LIM domain Repeat |
| Ligand | ATP-binding Metal-binding Nucleotide-binding Zinc |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | spermatogenesis Inferred from mutant phenotype PubMed 11784110. Source: MGI |
| Cellular_component | cis-Golgi network Inferred from direct assay PubMed 16399995. Source: MGI cytoplasmInferred from direct assay PubMed 16399995. Source: MGI nucleusInferred from direct assay PubMed 16399995. Source: MGI |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW protein kinase activityInferred from mutant phenotype PubMed 11784110. Source: MGI protein serine/threonine kinase activityInferred from electronic annotation. Source: UniProtKB-KW zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O54785-1) Also known as: LIMK2a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O54785-2) Also known as: LIMK2b; The sequence of this isoform differs from the canonical sequence as follows: 1-37: MAALAGDEAWRCRGCGTYVPLSQRLYRTANEAWHGSC → MGSYLSVPAYFTSRDP | ||||||
| Isoform 3 (identifier: O54785-3) Also known as: LIMK2t; tLIMK2; The sequence of this isoform differs from the canonical sequence as follows: 1-187: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 638 | 638 | LIM domain kinase 2 | PRO_0000075810 | ||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||
| Domain | 12 – 63 | 52 | LIM zinc-binding 1 | |||||||||||||||||||||||||||
| Domain | 72 – 124 | 53 | LIM zinc-binding 2 | |||||||||||||||||||||||||||
| Domain | 152 – 239 | 88 | PDZ | |||||||||||||||||||||||||||
| Domain | 331 – 608 | 278 | Protein kinase | |||||||||||||||||||||||||||
| Nucleotide binding | 337 – 345 | 9 | ATP By similarity | |||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||
| Active site | 451 | 1 | By similarity | |||||||||||||||||||||||||||
| Binding site | 360 | 1 | ATP By similarity | |||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||
| Modified residue | 210 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||
| Modified residue | 293 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||
| Modified residue | 298 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||
| Modified residue | 505 | 1 | Phosphothreonine; by ROCK1 and CDC42BP By similarity | |||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 187 | 187 | Missing in isoform 3. | VSP_010351 | ||||||||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | MAALA…WHGSC → MGSYLSVPAYFTSRDP in isoform 2. | VSP_010350 | ||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Beta strand | 149 – 155 | 7 | ||||||||||||||||||||||||||||
| Beta strand | 159 – 162 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 164 – 170 | 7 | ||||||||||||||||||||||||||||
| Beta strand | 174 – 176 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 179 – 184 | 6 | ||||||||||||||||||||||||||||
| Turn | 187 – 189 | 3 | ||||||||||||||||||||||||||||
| Helix | 194 – 197 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 204 – 211 | 8 | ||||||||||||||||||||||||||||
| Turn | 212 – 214 | 3 | ||||||||||||||||||||||||||||
| Helix | 217 – 225 | 9 | ||||||||||||||||||||||||||||
| Beta strand | 231 – 237 | 7 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning, genomic organization, and chromosomal localization of the mouse LIM motif-containing kinase gene, Limk2." Koshimizu U., Takahashi H., Yoshida M.C., Nakamura T. Biochem. Biophys. Res. Commun. 241:243-250(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: ICR. Tissue: Embryo. |
| [2] | "Mouse LIM-kinase 2 gene: cDNA cloning, genomic organization, and tissue-specific expression of two alternatively initiated transcripts." Ikebe C., Ohashi K., Fujimori T., Bernard O., Noda T., Robertson E.J., Mizuno K. Genomics 46:504-508(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2). Strain: 129/Sv. Tissue: Kidney. |
| [3] | "A novel transcript encoding truncated LIM kinase 2 is specifically expressed in male germ cells undergoing meiosis." Takahashi H., Koshimizu U., Nakamura T. Biochem. Biophys. Res. Commun. 249:138-145(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Testis. |
| [4] | "Identification of testis-specific (LimK2t) and brain-specific (LimK2c) isoforms of mouse LIM-kinase 2 gene transcripts." Ikebe C., Ohashi K., Mizuno K. Biochem. Biophys. Res. Commun. 246:307-312(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Testis. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Mammary tumor. |
| [6] | "Nischarin inhibits LIM kinase to regulate cofilin phosphorylation and cell invasion." Ding Y., Milosavljevic T., Alahari S.K. Mol. Cell. Biol. 28:3742-3756(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NISCH. |
| [7] | "Solution structure of the PDZ domain from mouse LIM domain kinase." RIKEN structural genomics initiative (RSGI) Submitted (APR-2008) to the PDB data bank Cited for: STRUCTURE BY NMR OF 139-246. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB008117 mRNA. Translation: BAA29035.1. AB005140 Genomic DNA. Translation: BAA24491.1. AB005131 mRNA. Translation: BAA24488.1. AB005132 mRNA. Translation: BAA24489.1. AB005134 Genomic DNA. Translation: BAA24490.1. U88618 mRNA. Translation: AAC39947.1. AB012291 mRNA. Translation: BAA32437.1. AB012092 mRNA. Translation: BAA31147.1. BC007129 mRNA. Translation: AAH07129.1. | ||||||||||||
| IPI | IPI00283633. IPI00417118. IPI00469661. | ||||||||||||
| PIR | JC5813. JC5814. JE0240. | ||||||||||||
| RefSeq | NP_001029202.1. NM_001034030.1. NP_034848.1. NM_010718.3. NP_774958.1. NM_173053.1. | ||||||||||||
| UniGene | Mm.124176. Mm.390323. Mm.442189. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O54785. | ||||||||||||
| SMR | O54785. Positions 9-132, 139-246, 276-623. | ||||||||||||
| ModBase | Search... | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O54785. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O54785. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000101638; ENSMUSP00000099162; ENSMUSG00000020451. ENSMUST00000101642; ENSMUSP00000099165; ENSMUSG00000020451. ENSMUST00000110029; ENSMUSP00000105656; ENSMUSG00000020451. | ||||||||||||
| GeneID | 16886. | ||||||||||||
| KEGG | mmu:16886. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 3985. | ||||||||||||
| MGI | MGI:1197517. Limk2. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0515. | ||||||||||||
| GeneTree | ENSGT00530000063025. | ||||||||||||
| HOGENOM | HOG000013121. | ||||||||||||
| HOVERGEN | HBG052328. | ||||||||||||
| InParanoid | O54785. | ||||||||||||
| KO | K05744. | ||||||||||||
| OMA | DARLSPH. | ||||||||||||
| OrthoDB | EOG4C87RX. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O54785. | ||||||||||||
| Bgee | O54785. | ||||||||||||
| CleanEx | MM_LIMK2. | ||||||||||||
| Genevestigator | O54785. | ||||||||||||
| GermOnline | ENSMUSG00000020451. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.10.110.10. 2 hits. | ||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR001478. PDZ. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||
| Pfam | PF00412. LIM. 2 hits. PF00595. PDZ. 1 hit. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00132. LIM. 2 hits. SM00228. PDZ. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. SSF50156. PDZ. 1 hit. | ||||||||||||
| PROSITE | PS00478. LIM_DOMAIN_1. 2 hits. PS50023. LIM_DOMAIN_2. 2 hits. PS50106. PDZ. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | O54785. | ||||||||||||
| NextBio | 290896. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | LIMK2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O54785 Secondary accession number(s): O54776, O55238, Q9QUL4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
