Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O54785

- LIMK2_MOUSE

UniProt

O54785 - LIMK2_MOUSE

Protein

LIM domain kinase 2

Gene

Limk2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 2 (01 Aug 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.By similarity

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei360 – 3601ATPPROSITE-ProRule annotation
    Active sitei451 – 4511By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi337 – 3459ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. protein heterodimerization activity Source: MGI
    3. protein kinase activity Source: MGI
    4. protein serine/threonine kinase activity Source: UniProtKB-KW
    5. zinc ion binding Source: InterPro

    GO - Biological processi

    1. protein phosphorylation Source: MGI
    2. spermatogenesis Source: MGI

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Metal-binding, Nucleotide-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    LIM domain kinase 2 (EC:2.7.11.1)
    Short name:
    LIMK-2
    Gene namesi
    Name:Limk2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:1197517. Limk2.

    Subcellular locationi

    GO - Cellular componenti

    1. cis-Golgi network Source: MGI
    2. cytoplasm Source: MGI
    3. nucleus Source: MGI

    Keywords - Cellular componenti

    Cytoplasm

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 638638LIM domain kinase 2PRO_0000075810Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei210 – 2101PhosphothreonineBy similarity
    Modified residuei293 – 2931PhosphoserineBy similarity
    Modified residuei298 – 2981PhosphoserineBy similarity
    Modified residuei505 – 5051Phosphothreonine; by ROCK1 and CDC42BPBy similarity

    Post-translational modificationi

    Phosphorylated on serine and/or threonine residues by ROCK1.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO54785.
    PRIDEiO54785.

    PTM databases

    PhosphoSiteiO54785.

    Expressioni

    Tissue specificityi

    Isoform 3 is testis specific.

    Gene expression databases

    ArrayExpressiO54785.
    BgeeiO54785.
    CleanExiMM_LIMK2.
    GenevestigatoriO54785.

    Interactioni

    Subunit structurei

    Binds ROCK1 and LKAP. Interacts with PARD3 By similarity. Interacts with NISCH.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi201167. 2 interactions.

    Structurei

    Secondary structure

    1
    638
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi149 – 1557
    Beta strandi159 – 1624
    Beta strandi164 – 1707
    Beta strandi174 – 1763
    Beta strandi179 – 1846
    Turni187 – 1893
    Helixi194 – 1974
    Beta strandi204 – 2118
    Turni212 – 2143
    Helixi217 – 2259
    Beta strandi231 – 2377

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2YUBNMR-A142-246[»]
    ProteinModelPortaliO54785.
    SMRiO54785. Positions 12-132, 139-246, 276-623.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO54785.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini12 – 6352LIM zinc-binding 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini72 – 12453LIM zinc-binding 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini152 – 23988PDZPROSITE-ProRule annotationAdd
    BLAST
    Domaini331 – 608278Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Keywords - Domaini

    LIM domain, Repeat

    Phylogenomic databases

    eggNOGiCOG0515.
    GeneTreeiENSGT00530000063025.
    HOGENOMiHOG000013121.
    HOVERGENiHBG052328.
    InParanoidiO54785.
    KOiK05744.
    OMAiDARLSPH.
    OrthoDBiEOG73V6JQ.
    PhylomeDBiO54785.
    TreeFamiTF318014.

    Family and domain databases

    Gene3Di2.10.110.10. 2 hits.
    2.30.42.10. 1 hit.
    InterProiIPR011009. Kinase-like_dom.
    IPR001478. PDZ.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR001781. Znf_LIM.
    [Graphical view]
    PfamiPF00412. LIM. 2 hits.
    PF00595. PDZ. 1 hit.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view]
    SMARTiSM00132. LIM. 2 hits.
    SM00228. PDZ. 1 hit.
    [Graphical view]
    SUPFAMiSSF50156. SSF50156. 1 hit.
    SSF56112. SSF56112. 1 hit.
    PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 2 hits.
    PS50106. PDZ. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O54785-1) [UniParc]FASTAAdd to Basket

    Also known as: LIMK2a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAALAGDEAW RCRGCGTYVP LSQRLYRTAN EAWHGSCFRC SECQESLTNW    50
    YYEKDGKLYC HKDYWAKFGE FCHGCSLLMT GPAMVAGEFK YHPECFACMS 100
    CKVIIEDGDA YALVQHATLY CGKCHNEVVL APMFERLSTE SVQDQLPYSV 150
    TLISMPATTE CRRGFSVTVE SASSNYATTV QVKEVNRMHI SPNNRNAIHP 200
    GDRILEINGT PVRTLRVEEV EDAIKQTSQT LQLLIEHDPV PQRLDQLRLD 250
    ARLPPHMQST GHTLMLSTLD TKENQEGTLR RRSLRRSNSI SKSPGPSSPK 300
    EPLLLSRDIS RSESLRCSSS YSQQIFRPCD LIHGEVLGKG FFGQAIKVTH 350
    KATGKVMVMK ELIRCDEETQ KTFLTEVKVM RSLDHPNVLK FIGVLYKDKK 400
    LNLLTEYIEG GTLKDFLRSV DPFPWQQKVR FAKGISSGMA YLHSMCIIHR 450
    DLNSHNCLIK LDKTVVVADF GLSRLIVEER KRPPVEKATT KKRTLRKSDR 500
    KKRYTVVGNP YWMAPEMLNG KSYDETVDVF SFGIVLCEII GQVYADPDCL 550
    PRTLDFGLNV KLFWEKFVPT DCPPAFFPLA AICCKLEPES RPAFSKLEDS 600
    FEALSLFLGE LAIPLPAELE DLDHTVSMEY GLTRDSPP 638
    Length:638
    Mass (Da):72,202
    Last modified:August 1, 1998 - v2
    Checksum:i54CFA5E7A6A79C39
    GO
    Isoform 2 (identifier: O54785-2) [UniParc]FASTAAdd to Basket

    Also known as: LIMK2b

    The sequence of this isoform differs from the canonical sequence as follows:
         1-37: MAALAGDEAWRCRGCGTYVPLSQRLYRTANEAWHGSC → MGSYLSVPAYFTSRDP

    Show »
    Length:617
    Mass (Da):69,891
    Checksum:i1E2DCE61958B8D0B
    GO
    Isoform 3 (identifier: O54785-3) [UniParc]FASTAAdd to Basket

    Also known as: LIMK2t, tLIMK2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-187: Missing.

    Show »
    Length:451
    Mass (Da):51,173
    Checksum:i883063D71E077C2B
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 187187Missing in isoform 3. 2 PublicationsVSP_010351Add
    BLAST
    Alternative sequencei1 – 3737MAALA…WHGSC → MGSYLSVPAYFTSRDP in isoform 2. 1 PublicationVSP_010350Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB008117 mRNA. Translation: BAA29035.1.
    AB005140 Genomic DNA. Translation: BAA24491.1.
    AB005131 mRNA. Translation: BAA24488.1.
    AB005132 mRNA. Translation: BAA24489.1.
    AB005134 Genomic DNA. Translation: BAA24490.1.
    U88618 mRNA. Translation: AAC39947.1.
    AB012291 mRNA. Translation: BAA32437.1.
    AB012092 mRNA. Translation: BAA31147.1.
    BC007129 mRNA. Translation: AAH07129.1.
    CCDSiCCDS24358.1. [O54785-1]
    CCDS24359.1. [O54785-2]
    CCDS24360.1. [O54785-3]
    PIRiJC5813.
    JC5814.
    JE0240.
    RefSeqiNP_001029202.1. NM_001034030.2. [O54785-3]
    NP_034848.1. NM_010718.4. [O54785-1]
    NP_774958.1. NM_173053.1. [O54785-2]
    UniGeneiMm.124176.
    Mm.390323.
    Mm.442189.

    Genome annotation databases

    EnsembliENSMUST00000101638; ENSMUSP00000099162; ENSMUSG00000020451. [O54785-1]
    ENSMUST00000101642; ENSMUSP00000099165; ENSMUSG00000020451. [O54785-2]
    ENSMUST00000110029; ENSMUSP00000105656; ENSMUSG00000020451. [O54785-3]
    GeneIDi16886.
    KEGGimmu:16886.
    UCSCiuc007hss.1. mouse. [O54785-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB008117 mRNA. Translation: BAA29035.1 .
    AB005140 Genomic DNA. Translation: BAA24491.1 .
    AB005131 mRNA. Translation: BAA24488.1 .
    AB005132 mRNA. Translation: BAA24489.1 .
    AB005134 Genomic DNA. Translation: BAA24490.1 .
    U88618 mRNA. Translation: AAC39947.1 .
    AB012291 mRNA. Translation: BAA32437.1 .
    AB012092 mRNA. Translation: BAA31147.1 .
    BC007129 mRNA. Translation: AAH07129.1 .
    CCDSi CCDS24358.1. [O54785-1 ]
    CCDS24359.1. [O54785-2 ]
    CCDS24360.1. [O54785-3 ]
    PIRi JC5813.
    JC5814.
    JE0240.
    RefSeqi NP_001029202.1. NM_001034030.2. [O54785-3 ]
    NP_034848.1. NM_010718.4. [O54785-1 ]
    NP_774958.1. NM_173053.1. [O54785-2 ]
    UniGenei Mm.124176.
    Mm.390323.
    Mm.442189.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2YUB NMR - A 142-246 [» ]
    ProteinModelPortali O54785.
    SMRi O54785. Positions 12-132, 139-246, 276-623.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 201167. 2 interactions.

    PTM databases

    PhosphoSitei O54785.

    Proteomic databases

    MaxQBi O54785.
    PRIDEi O54785.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000101638 ; ENSMUSP00000099162 ; ENSMUSG00000020451 . [O54785-1 ]
    ENSMUST00000101642 ; ENSMUSP00000099165 ; ENSMUSG00000020451 . [O54785-2 ]
    ENSMUST00000110029 ; ENSMUSP00000105656 ; ENSMUSG00000020451 . [O54785-3 ]
    GeneIDi 16886.
    KEGGi mmu:16886.
    UCSCi uc007hss.1. mouse. [O54785-1 ]

    Organism-specific databases

    CTDi 3985.
    MGIi MGI:1197517. Limk2.

    Phylogenomic databases

    eggNOGi COG0515.
    GeneTreei ENSGT00530000063025.
    HOGENOMi HOG000013121.
    HOVERGENi HBG052328.
    InParanoidi O54785.
    KOi K05744.
    OMAi DARLSPH.
    OrthoDBi EOG73V6JQ.
    PhylomeDBi O54785.
    TreeFami TF318014.

    Miscellaneous databases

    EvolutionaryTracei O54785.
    NextBioi 290896.
    PROi O54785.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O54785.
    Bgeei O54785.
    CleanExi MM_LIMK2.
    Genevestigatori O54785.

    Family and domain databases

    Gene3Di 2.10.110.10. 2 hits.
    2.30.42.10. 1 hit.
    InterProi IPR011009. Kinase-like_dom.
    IPR001478. PDZ.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR001781. Znf_LIM.
    [Graphical view ]
    Pfami PF00412. LIM. 2 hits.
    PF00595. PDZ. 1 hit.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view ]
    SMARTi SM00132. LIM. 2 hits.
    SM00228. PDZ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50156. SSF50156. 1 hit.
    SSF56112. SSF56112. 1 hit.
    PROSITEi PS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 2 hits.
    PS50106. PDZ. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "cDNA cloning, genomic organization, and chromosomal localization of the mouse LIM motif-containing kinase gene, Limk2."
      Koshimizu U., Takahashi H., Yoshida M.C., Nakamura T.
      Biochem. Biophys. Res. Commun. 241:243-250(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: ICR.
      Tissue: Embryo.
    2. "Mouse LIM-kinase 2 gene: cDNA cloning, genomic organization, and tissue-specific expression of two alternatively initiated transcripts."
      Ikebe C., Ohashi K., Fujimori T., Bernard O., Noda T., Robertson E.J., Mizuno K.
      Genomics 46:504-508(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2).
      Strain: 129/Sv.
      Tissue: Kidney.
    3. "A novel transcript encoding truncated LIM kinase 2 is specifically expressed in male germ cells undergoing meiosis."
      Takahashi H., Koshimizu U., Nakamura T.
      Biochem. Biophys. Res. Commun. 249:138-145(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
      Tissue: Testis.
    4. "Identification of testis-specific (LimK2t) and brain-specific (LimK2c) isoforms of mouse LIM-kinase 2 gene transcripts."
      Ikebe C., Ohashi K., Mizuno K.
      Biochem. Biophys. Res. Commun. 246:307-312(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
      Tissue: Testis.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Mammary tumor.
    6. "Nischarin inhibits LIM kinase to regulate cofilin phosphorylation and cell invasion."
      Ding Y., Milosavljevic T., Alahari S.K.
      Mol. Cell. Biol. 28:3742-3756(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH NISCH.
    7. "Solution structure of the PDZ domain from mouse LIM domain kinase."
      RIKEN structural genomics initiative (RSGI)
      Submitted (APR-2008) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 139-246.

    Entry informationi

    Entry nameiLIMK2_MOUSE
    AccessioniPrimary (citable) accession number: O54785
    Secondary accession number(s): O54776, O55238, Q9QUL4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 24, 2004
    Last sequence update: August 1, 1998
    Last modified: October 1, 2014
    This is version 129 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3