Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM domain kinase 2

Gene

Limk2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.By similarity

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei360ATPPROSITE-ProRule annotation1
Active sitei451By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi337 – 345ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • protein heterodimerization activity Source: MGI
  • protein kinase activity Source: MGI
  • protein serine/threonine kinase activity Source: UniProtKB-KW
  • zinc ion binding Source: InterPro

GO - Biological processi

  • protein phosphorylation Source: MGI
  • spermatogenesis Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain kinase 2 (EC:2.7.11.1)
Short name:
LIMK-2
Gene namesi
Name:Limk2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1197517. Limk2.

Subcellular locationi

GO - Cellular componenti

  • cis-Golgi network Source: MGI
  • cytoplasm Source: MGI
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000758101 – 638LIM domain kinase 2Add BLAST638

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei210PhosphothreonineBy similarity1
Modified residuei293PhosphoserineBy similarity1
Modified residuei298PhosphoserineBy similarity1
Modified residuei505Phosphothreonine; by ROCK1 and CDC42BPBy similarity1

Post-translational modificationi

Phosphorylated on serine and/or threonine residues by ROCK1.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiO54785.
PeptideAtlasiO54785.
PRIDEiO54785.

PTM databases

iPTMnetiO54785.
PhosphoSitePlusiO54785.

Expressioni

Tissue specificityi

Isoform 3 is testis specific.

Gene expression databases

BgeeiENSMUSG00000020451.
CleanExiMM_LIMK2.
ExpressionAtlasiO54785. baseline and differential.
GenevisibleiO54785. MM.

Interactioni

Subunit structurei

Binds ROCK1 and LKAP. Interacts with PARD3 (By similarity). Interacts with NISCH.By similarity1 Publication

GO - Molecular functioni

  • protein heterodimerization activity Source: MGI

Protein-protein interaction databases

BioGridi201167. 2 interactors.
STRINGi10090.ENSMUSP00000099162.

Structurei

Secondary structure

1638
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi149 – 155Combined sources7
Beta strandi159 – 162Combined sources4
Beta strandi164 – 170Combined sources7
Beta strandi174 – 176Combined sources3
Beta strandi179 – 184Combined sources6
Turni187 – 189Combined sources3
Helixi194 – 197Combined sources4
Beta strandi204 – 211Combined sources8
Turni212 – 214Combined sources3
Helixi217 – 225Combined sources9
Beta strandi231 – 237Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YUBNMR-A142-246[»]
ProteinModelPortaliO54785.
SMRiO54785.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO54785.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini12 – 63LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST52
Domaini72 – 124LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST53
Domaini152 – 239PDZPROSITE-ProRule annotationAdd BLAST88
Domaini331 – 608Protein kinasePROSITE-ProRule annotationAdd BLAST278

Sequence similaritiesi

Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiENOG410IEZ9. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00530000063025.
HOGENOMiHOG000013121.
HOVERGENiHBG052328.
InParanoidiO54785.
KOiK05744.
OMAiPECLPRT.
OrthoDBiEOG091G03ZL.
PhylomeDBiO54785.
TreeFamiTF318014.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
PF00595. PDZ. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS50106. PDZ. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O54785-1) [UniParc]FASTAAdd to basket
Also known as: LIMK2a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAALAGDEAW RCRGCGTYVP LSQRLYRTAN EAWHGSCFRC SECQESLTNW
60 70 80 90 100
YYEKDGKLYC HKDYWAKFGE FCHGCSLLMT GPAMVAGEFK YHPECFACMS
110 120 130 140 150
CKVIIEDGDA YALVQHATLY CGKCHNEVVL APMFERLSTE SVQDQLPYSV
160 170 180 190 200
TLISMPATTE CRRGFSVTVE SASSNYATTV QVKEVNRMHI SPNNRNAIHP
210 220 230 240 250
GDRILEINGT PVRTLRVEEV EDAIKQTSQT LQLLIEHDPV PQRLDQLRLD
260 270 280 290 300
ARLPPHMQST GHTLMLSTLD TKENQEGTLR RRSLRRSNSI SKSPGPSSPK
310 320 330 340 350
EPLLLSRDIS RSESLRCSSS YSQQIFRPCD LIHGEVLGKG FFGQAIKVTH
360 370 380 390 400
KATGKVMVMK ELIRCDEETQ KTFLTEVKVM RSLDHPNVLK FIGVLYKDKK
410 420 430 440 450
LNLLTEYIEG GTLKDFLRSV DPFPWQQKVR FAKGISSGMA YLHSMCIIHR
460 470 480 490 500
DLNSHNCLIK LDKTVVVADF GLSRLIVEER KRPPVEKATT KKRTLRKSDR
510 520 530 540 550
KKRYTVVGNP YWMAPEMLNG KSYDETVDVF SFGIVLCEII GQVYADPDCL
560 570 580 590 600
PRTLDFGLNV KLFWEKFVPT DCPPAFFPLA AICCKLEPES RPAFSKLEDS
610 620 630
FEALSLFLGE LAIPLPAELE DLDHTVSMEY GLTRDSPP
Length:638
Mass (Da):72,202
Last modified:August 1, 1998 - v2
Checksum:i54CFA5E7A6A79C39
GO
Isoform 2 (identifier: O54785-2) [UniParc]FASTAAdd to basket
Also known as: LIMK2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MAALAGDEAWRCRGCGTYVPLSQRLYRTANEAWHGSC → MGSYLSVPAYFTSRDP

Show »
Length:617
Mass (Da):69,891
Checksum:i1E2DCE61958B8D0B
GO
Isoform 3 (identifier: O54785-3) [UniParc]FASTAAdd to basket
Also known as: LIMK2t, tLIMK2

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Show »
Length:451
Mass (Da):51,173
Checksum:i883063D71E077C2B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0103511 – 187Missing in isoform 3. 2 PublicationsAdd BLAST187
Alternative sequenceiVSP_0103501 – 37MAALA…WHGSC → MGSYLSVPAYFTSRDP in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB008117 mRNA. Translation: BAA29035.1.
AB005140 Genomic DNA. Translation: BAA24491.1.
AB005131 mRNA. Translation: BAA24488.1.
AB005132 mRNA. Translation: BAA24489.1.
AB005134 Genomic DNA. Translation: BAA24490.1.
U88618 mRNA. Translation: AAC39947.1.
AB012291 mRNA. Translation: BAA32437.1.
AB012092 mRNA. Translation: BAA31147.1.
BC007129 mRNA. Translation: AAH07129.1.
CCDSiCCDS24358.1. [O54785-1]
CCDS24359.1. [O54785-2]
CCDS24360.1. [O54785-3]
PIRiJC5813.
JC5814.
JE0240.
RefSeqiNP_001029202.1. NM_001034030.2. [O54785-3]
NP_034848.1. NM_010718.4. [O54785-1]
NP_774958.1. NM_173053.1. [O54785-2]
UniGeneiMm.124176.
Mm.390323.
Mm.442189.

Genome annotation databases

EnsembliENSMUST00000101638; ENSMUSP00000099162; ENSMUSG00000020451. [O54785-1]
ENSMUST00000101642; ENSMUSP00000099165; ENSMUSG00000020451. [O54785-2]
ENSMUST00000110029; ENSMUSP00000105656; ENSMUSG00000020451. [O54785-3]
GeneIDi16886.
KEGGimmu:16886.
UCSCiuc007hss.1. mouse. [O54785-1]
uc007hst.1. mouse. [O54785-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB008117 mRNA. Translation: BAA29035.1.
AB005140 Genomic DNA. Translation: BAA24491.1.
AB005131 mRNA. Translation: BAA24488.1.
AB005132 mRNA. Translation: BAA24489.1.
AB005134 Genomic DNA. Translation: BAA24490.1.
U88618 mRNA. Translation: AAC39947.1.
AB012291 mRNA. Translation: BAA32437.1.
AB012092 mRNA. Translation: BAA31147.1.
BC007129 mRNA. Translation: AAH07129.1.
CCDSiCCDS24358.1. [O54785-1]
CCDS24359.1. [O54785-2]
CCDS24360.1. [O54785-3]
PIRiJC5813.
JC5814.
JE0240.
RefSeqiNP_001029202.1. NM_001034030.2. [O54785-3]
NP_034848.1. NM_010718.4. [O54785-1]
NP_774958.1. NM_173053.1. [O54785-2]
UniGeneiMm.124176.
Mm.390323.
Mm.442189.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YUBNMR-A142-246[»]
ProteinModelPortaliO54785.
SMRiO54785.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201167. 2 interactors.
STRINGi10090.ENSMUSP00000099162.

PTM databases

iPTMnetiO54785.
PhosphoSitePlusiO54785.

Proteomic databases

PaxDbiO54785.
PeptideAtlasiO54785.
PRIDEiO54785.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000101638; ENSMUSP00000099162; ENSMUSG00000020451. [O54785-1]
ENSMUST00000101642; ENSMUSP00000099165; ENSMUSG00000020451. [O54785-2]
ENSMUST00000110029; ENSMUSP00000105656; ENSMUSG00000020451. [O54785-3]
GeneIDi16886.
KEGGimmu:16886.
UCSCiuc007hss.1. mouse. [O54785-1]
uc007hst.1. mouse. [O54785-2]

Organism-specific databases

CTDi3985.
MGIiMGI:1197517. Limk2.

Phylogenomic databases

eggNOGiENOG410IEZ9. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00530000063025.
HOGENOMiHOG000013121.
HOVERGENiHBG052328.
InParanoidiO54785.
KOiK05744.
OMAiPECLPRT.
OrthoDBiEOG091G03ZL.
PhylomeDBiO54785.
TreeFamiTF318014.

Miscellaneous databases

EvolutionaryTraceiO54785.
PROiO54785.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020451.
CleanExiMM_LIMK2.
ExpressionAtlasiO54785. baseline and differential.
GenevisibleiO54785. MM.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
PF00595. PDZ. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS50106. PDZ. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLIMK2_MOUSE
AccessioniPrimary (citable) accession number: O54785
Secondary accession number(s): O54776, O55238, Q9QUL4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: August 1, 1998
Last modified: November 2, 2016
This is version 144 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.