Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O54785 (LIMK2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
LIM domain kinase 2

Short name=LIMK-2
EC=2.7.11.1
Gene names
Name:Limk2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length638 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro By similarity.

Catalytic activity

ATP + a protein = ADP + a phosphoprotein.

Subunit structure

Binds ROCK1 and LKAP. Interacts with PARD3 By similarity. Interacts with NISCH. Ref.6

Subcellular location

Cytoplasm.

Tissue specificity

Isoform 3 is testis specific.

Post-translational modification

Phosphorylated on serine and/or threonine residues by ROCK1 By similarity.

Sequence similarities

Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.

Contains 2 LIM zinc-binding domains.

Contains 1 PDZ (DHR) domain.

Contains 1 protein kinase domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O54785-1)

Also known as: LIMK2a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O54785-2)

Also known as: LIMK2b;

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MAALAGDEAWRCRGCGTYVPLSQRLYRTANEAWHGSC → MGSYLSVPAYFTSRDP
Isoform 3 (identifier: O54785-3)

Also known as: LIMK2t; tLIMK2;

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 638638LIM domain kinase 2
PRO_0000075810

Regions

Domain12 – 6352LIM zinc-binding 1
Domain72 – 12453LIM zinc-binding 2
Domain152 – 23988PDZ
Domain331 – 608278Protein kinase
Nucleotide binding337 – 3459ATP By similarity

Sites

Active site4511 By similarity
Binding site3601ATP By similarity

Amino acid modifications

Modified residue2101Phosphothreonine By similarity
Modified residue2931Phosphoserine By similarity
Modified residue2981Phosphoserine By similarity
Modified residue5051Phosphothreonine; by ROCK1 and CDC42BP By similarity

Natural variations

Alternative sequence1 – 187187Missing in isoform 3.
VSP_010351
Alternative sequence1 – 3737MAALA…WHGSC → MGSYLSVPAYFTSRDP in isoform 2.
VSP_010350

Secondary structure

...................... 638
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (LIMK2a) [UniParc].

Last modified August 1, 1998. Version 2.
Checksum: 54CFA5E7A6A79C39

FASTA63872,202
        10         20         30         40         50         60 
MAALAGDEAW RCRGCGTYVP LSQRLYRTAN EAWHGSCFRC SECQESLTNW YYEKDGKLYC 

        70         80         90        100        110        120 
HKDYWAKFGE FCHGCSLLMT GPAMVAGEFK YHPECFACMS CKVIIEDGDA YALVQHATLY 

       130        140        150        160        170        180 
CGKCHNEVVL APMFERLSTE SVQDQLPYSV TLISMPATTE CRRGFSVTVE SASSNYATTV 

       190        200        210        220        230        240 
QVKEVNRMHI SPNNRNAIHP GDRILEINGT PVRTLRVEEV EDAIKQTSQT LQLLIEHDPV 

       250        260        270        280        290        300 
PQRLDQLRLD ARLPPHMQST GHTLMLSTLD TKENQEGTLR RRSLRRSNSI SKSPGPSSPK 

       310        320        330        340        350        360 
EPLLLSRDIS RSESLRCSSS YSQQIFRPCD LIHGEVLGKG FFGQAIKVTH KATGKVMVMK 

       370        380        390        400        410        420 
ELIRCDEETQ KTFLTEVKVM RSLDHPNVLK FIGVLYKDKK LNLLTEYIEG GTLKDFLRSV 

       430        440        450        460        470        480 
DPFPWQQKVR FAKGISSGMA YLHSMCIIHR DLNSHNCLIK LDKTVVVADF GLSRLIVEER 

       490        500        510        520        530        540 
KRPPVEKATT KKRTLRKSDR KKRYTVVGNP YWMAPEMLNG KSYDETVDVF SFGIVLCEII 

       550        560        570        580        590        600 
GQVYADPDCL PRTLDFGLNV KLFWEKFVPT DCPPAFFPLA AICCKLEPES RPAFSKLEDS 

       610        620        630 
FEALSLFLGE LAIPLPAELE DLDHTVSMEY GLTRDSPP 

« Hide

Isoform 2 (LIMK2b) [UniParc].

Checksum: 1E2DCE61958B8D0B
Show »

FASTA61769,891
Isoform 3 (LIMK2t) (tLIMK2) [UniParc].

Checksum: 883063D71E077C2B
Show »

FASTA45151,173

References

« Hide 'large scale' references
[1]"cDNA cloning, genomic organization, and chromosomal localization of the mouse LIM motif-containing kinase gene, Limk2."
Koshimizu U., Takahashi H., Yoshida M.C., Nakamura T.
Biochem. Biophys. Res. Commun. 241:243-250(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: ICR.
Tissue: Embryo.
[2]"Mouse LIM-kinase 2 gene: cDNA cloning, genomic organization, and tissue-specific expression of two alternatively initiated transcripts."
Ikebe C., Ohashi K., Fujimori T., Bernard O., Noda T., Robertson E.J., Mizuno K.
Genomics 46:504-508(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2).
Strain: 129/Sv.
Tissue: Kidney.
[3]"A novel transcript encoding truncated LIM kinase 2 is specifically expressed in male germ cells undergoing meiosis."
Takahashi H., Koshimizu U., Nakamura T.
Biochem. Biophys. Res. Commun. 249:138-145(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Testis.
[4]"Identification of testis-specific (LimK2t) and brain-specific (LimK2c) isoforms of mouse LIM-kinase 2 gene transcripts."
Ikebe C., Ohashi K., Mizuno K.
Biochem. Biophys. Res. Commun. 246:307-312(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Testis.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Mammary tumor.
[6]"Nischarin inhibits LIM kinase to regulate cofilin phosphorylation and cell invasion."
Ding Y., Milosavljevic T., Alahari S.K.
Mol. Cell. Biol. 28:3742-3756(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH NISCH.
[7]"Solution structure of the PDZ domain from mouse LIM domain kinase."
RIKEN structural genomics initiative (RSGI)
Submitted (APR-2008) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 139-246.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB008117 mRNA. Translation: BAA29035.1.
AB005140 Genomic DNA. Translation: BAA24491.1.
AB005131 mRNA. Translation: BAA24488.1.
AB005132 mRNA. Translation: BAA24489.1.
AB005134 Genomic DNA. Translation: BAA24490.1.
U88618 mRNA. Translation: AAC39947.1.
AB012291 mRNA. Translation: BAA32437.1.
AB012092 mRNA. Translation: BAA31147.1.
BC007129 mRNA. Translation: AAH07129.1.
CCDSCCDS24358.1. [O54785-1]
CCDS24359.1. [O54785-2]
CCDS24360.1. [O54785-3]
PIRJC5813.
JC5814.
JE0240.
RefSeqNP_001029202.1. NM_001034030.2. [O54785-3]
NP_034848.1. NM_010718.4. [O54785-1]
NP_774958.1. NM_173053.1. [O54785-2]
UniGeneMm.124176.
Mm.390323.
Mm.442189.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2YUBNMR-A142-246[»]
ProteinModelPortalO54785.
SMRO54785. Positions 12-132, 139-246, 276-623.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid201167. 2 interactions.

PTM databases

PhosphoSiteO54785.

Proteomic databases

MaxQBO54785.
PRIDEO54785.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000101638; ENSMUSP00000099162; ENSMUSG00000020451. [O54785-1]
ENSMUST00000101642; ENSMUSP00000099165; ENSMUSG00000020451. [O54785-2]
ENSMUST00000110029; ENSMUSP00000105656; ENSMUSG00000020451. [O54785-3]
GeneID16886.
KEGGmmu:16886.
UCSCuc007hss.1. mouse. [O54785-1]

Organism-specific databases

CTD3985.
MGIMGI:1197517. Limk2.

Phylogenomic databases

eggNOGCOG0515.
GeneTreeENSGT00530000063025.
HOGENOMHOG000013121.
HOVERGENHBG052328.
InParanoidO54785.
KOK05744.
OMADARLSPH.
OrthoDBEOG73V6JQ.
PhylomeDBO54785.
TreeFamTF318014.

Gene expression databases

ArrayExpressO54785.
BgeeO54785.
CleanExMM_LIMK2.
GenevestigatorO54785.

Family and domain databases

Gene3D2.10.110.10. 2 hits.
2.30.42.10. 1 hit.
InterProIPR011009. Kinase-like_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR001781. Znf_LIM.
[Graphical view]
PfamPF00412. LIM. 2 hits.
PF00595. PDZ. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTSM00132. LIM. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMSSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS50106. PDZ. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceO54785.
NextBio290896.
PROO54785.
SOURCESearch...

Entry information

Entry nameLIMK2_MOUSE
AccessionPrimary (citable) accession number: O54785
Secondary accession number(s): O54776, O55238, Q9QUL4
Entry history
Integrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: August 1, 1998
Last modified: July 9, 2014
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot