Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O48782

- HMOX1_ARATH

UniProt

O48782 - HMOX1_ARATH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Heme oxygenase 1, chloroplastic

Gene

HO1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Key enzyme in the synthesis of the chromophore of the phytochrome family of plant photoreceptors. Catalyzes the opening of the heme ring to form the open-chain tetrapyrrole biliverdin IX with the release of iron and carbon monoxide (CO). Produces specifically the biliverdin IX-alpha isomer. Can form complex with heme, is ferredoxin-dependent and its activity is increased in the presence of ascorbate. Plays a role in salt acclimation signaling. May affect the plastid-to-nucleus signaling pathway by perturbing tetrapyrrole synthesis. The plastid-to-nucleus signal plays an important role in the coordinated expression of both nuclear- and chloroplast-localized genes that encode photosynthesis-related proteins.12 Publications

Catalytic activityi

Protoheme + 3 AH2 + 3 O2 = biliverdin + Fe2+ + CO + 3 A + 3 H2O.2 Publications

Enzyme regulationi

Activated by ascorbate.1 Publication

Kineticsi

  1. KM=1.3 µM for hemin2 Publications
  2. KM=1.9 µM for ferredoxin2 Publications
  3. KM=420 µM for ascorbate2 Publications

pH dependencei

Optimum pH is 7.2.2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi86 – 861Iron (heme axial ligand)By similarity

GO - Molecular functioni

  1. heme binding Source: TAIR
  2. heme oxygenase (decyclizing) activity Source: TAIR
  3. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. carotenoid biosynthetic process Source: TAIR
  2. cellular response to UV-C Source: TAIR
  3. chloroplast-nucleus signaling pathway Source: TAIR
  4. flavonoid biosynthetic process Source: TAIR
  5. heme oxidation Source: InterPro
  6. photosynthesis Source: UniProtKB-KW
  7. phytochromobilin biosynthetic process Source: TAIR
  8. regulation of meristem growth Source: TAIR
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Photosynthesis

Keywords - Ligandi

Heme, Iron, Metal-binding

Enzyme and pathway databases

BioCyciARA:AT2G26670-MONOMER.
MetaCyc:AT2G26670-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Heme oxygenase 1, chloroplastic (EC:1.14.99.3)
Short name:
AtHO1
Alternative name(s):
Protein GENOMES UNCOUPLED 2
Protein REVERSAL OF THE DET PHENOTYPE 4
Gene namesi
Name:HO1
Synonyms:GUN2, HY1, HY6, TED4
Ordered Locus Names:At2g26670
ORF Names:F18A8.4
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548: Chromosome 2

Organism-specific databases

TAIRiAT2G26670.

Subcellular locationi

Plastidchloroplast 2 Publications

GO - Cellular componenti

  1. chloroplast Source: TAIR
Complete GO annotation...

Keywords - Cellular componenti

Chloroplast, Plastid

Pathology & Biotechi

Disruption phenotypei

Long hypocotyl, incomplete chloroplast and leaf development, lack of photoreversible phytochromes and lack of phytochromobilin, the phytochrome chromophore. No cotyledon expansion in response to bright-red light. Increased levels of jasmonate (JA) and constitutive expression of JA-inducible defense genes. Increased sensitivity to salt stress and no acclimation response to salinity.11 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 5454ChloroplastSequence AnalysisAdd
BLAST
Chaini55 – 282228Heme oxygenase 1, chloroplasticPRO_0000412185Add
BLAST

Proteomic databases

PRIDEiO48782.

Expressioni

Tissue specificityi

Widely expressed.3 Publications

Inductioni

By salt treatment. Down-regulated by jasmonate.2 Publications

Gene expression databases

GenevestigatoriO48782.

Interactioni

Protein-protein interaction databases

BioGridi2560. 1 interaction.
STRINGi3702.AT2G26670.1-P.

Structurei

3D structure databases

ProteinModelPortaliO48782.
SMRiO48782. Positions 88-277.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the heme oxygenase family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiNOG308332.
HOGENOMiHOG000265822.
InParanoidiO48782.
KOiK00510.
OMAiHTKDQAK.
PhylomeDBiO48782.

Family and domain databases

Gene3Di1.20.910.10. 1 hit.
InterProiIPR016053. Haem_Oase-like.
IPR016084. Haem_Oase-like_multi-hlx.
IPR016951. Haem_Oase_decyc_pln.
[Graphical view]
PfamiPF01126. Heme_oxygenase. 1 hit.
[Graphical view]
PIRSFiPIRSF030219. Heme_Oase_decyc_pln. 1 hit.
SUPFAMiSSF48613. SSF48613. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O48782-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAYLAPISSS LSIFKNPQLS RFQFSSSSPN PLFLRPRIQI LSMTMNKSPS
60 70 80 90 100
LVVVAATTAA EKQKKRYPGE SKGFVEEMRF VAMRLHTKDQ AKEGEKETKS
110 120 130 140 150
IEERPVAKWE PTVEGYLRFL VDSKLVYDTL ELIIQDSNFP TYAEFKNTGL
160 170 180 190 200
ERAEKLSTDL EWFKEQGYEI PEPTAPGKTY SQYLKELAEK DPQAFICHFY
210 220 230 240 250
NIYFAHSAGG RMIGRKVAER ILDNKELEFY KWDGELSQLL QNVREKLNKV
260 270 280
AEEWTREEKN HCLEETEKSF KYSGEILRLI LS
Length:282
Mass (Da):32,691
Last modified:November 1, 1999 - v2
Checksum:i65D9638890A3E8BA
GO
Isoform 2 (identifier: O48782-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     94-142: GEKETKSIEERPVAKWEPTVEGYLRFLVDSKLVYDTLELIIQDSNFPTY → D

Note: Derived from EST data. No experimental confirmation available.

Show »
Length:234
Mass (Da):27,076
Checksum:iD5350323BB620A1E
GO

Sequence cautioni

The sequence AAK52998.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei94 – 14249GEKET…NFPTY → D in isoform 2. CuratedVSP_041652Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB021857 Genomic DNA. Translation: BAA77758.1.
AB021858 mRNA. Translation: BAA77759.1.
AF132475 Genomic DNA. Translation: AAD22107.1.
AF132476 Genomic DNA. Translation: AAD22108.1.
AC003105 Genomic DNA. Translation: AAB95301.2.
CP002685 Genomic DNA. Translation: AEC07872.1.
CP002685 Genomic DNA. Translation: AEC07873.1.
AF327418 mRNA. Translation: AAG42008.2.
AF375414 mRNA. Translation: AAK52998.1. Different initiation.
AY129477 mRNA. Translation: AAM91063.1.
BT002327 mRNA. Translation: AAN86160.1.
AY087288 mRNA. Translation: AAM64841.1.
PIRiT52457.
RefSeqiNP_001118392.1. NM_001124920.1. [O48782-2]
NP_180235.1. NM_128224.2. [O48782-1]
UniGeneiAt.23645.

Genome annotation databases

EnsemblPlantsiAT2G26670.1; AT2G26670.1; AT2G26670. [O48782-1]
GeneIDi817208.
KEGGiath:AT2G26670.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB021857 Genomic DNA. Translation: BAA77758.1 .
AB021858 mRNA. Translation: BAA77759.1 .
AF132475 Genomic DNA. Translation: AAD22107.1 .
AF132476 Genomic DNA. Translation: AAD22108.1 .
AC003105 Genomic DNA. Translation: AAB95301.2 .
CP002685 Genomic DNA. Translation: AEC07872.1 .
CP002685 Genomic DNA. Translation: AEC07873.1 .
AF327418 mRNA. Translation: AAG42008.2 .
AF375414 mRNA. Translation: AAK52998.1 . Different initiation.
AY129477 mRNA. Translation: AAM91063.1 .
BT002327 mRNA. Translation: AAN86160.1 .
AY087288 mRNA. Translation: AAM64841.1 .
PIRi T52457.
RefSeqi NP_001118392.1. NM_001124920.1. [O48782-2 ]
NP_180235.1. NM_128224.2. [O48782-1 ]
UniGenei At.23645.

3D structure databases

ProteinModelPortali O48782.
SMRi O48782. Positions 88-277.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 2560. 1 interaction.
STRINGi 3702.AT2G26670.1-P.

Proteomic databases

PRIDEi O48782.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblPlantsi AT2G26670.1 ; AT2G26670.1 ; AT2G26670 . [O48782-1 ]
GeneIDi 817208.
KEGGi ath:AT2G26670.

Organism-specific databases

TAIRi AT2G26670.

Phylogenomic databases

eggNOGi NOG308332.
HOGENOMi HOG000265822.
InParanoidi O48782.
KOi K00510.
OMAi HTKDQAK.
PhylomeDBi O48782.

Enzyme and pathway databases

BioCyci ARA:AT2G26670-MONOMER.
MetaCyc:AT2G26670-MONOMER.

Gene expression databases

Genevestigatori O48782.

Family and domain databases

Gene3Di 1.20.910.10. 1 hit.
InterProi IPR016053. Haem_Oase-like.
IPR016084. Haem_Oase-like_multi-hlx.
IPR016951. Haem_Oase_decyc_pln.
[Graphical view ]
Pfami PF01126. Heme_oxygenase. 1 hit.
[Graphical view ]
PIRSFi PIRSF030219. Heme_Oase_decyc_pln. 1 hit.
SUPFAMi SSF48613. SSF48613. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The Arabidopsis photomorphogenic mutant hy1 is deficient in phytochrome chromophore biosynthesis as a result of a mutation in a plastid heme oxygenase."
    Muramoto T., Kohchi T., Yokota A., Hwang I., Goodman H.M.
    Plant Cell 11:335-348(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE.
    Strain: cv. Landsberg erecta.
  2. "The Arabidopsis thaliana HY1 locus, required for phytochrome-chromophore biosynthesis, encodes a protein related to heme oxygenases."
    Davis S.J., Kurepa J., Vierstra R.D.
    Proc. Natl. Acad. Sci. U.S.A. 96:6541-6546(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
    Strain: cv. Columbia and cv. Landsberg erecta.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  4. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  5. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
    Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
    , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
    Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: cv. Columbia.
  6. "Full-length cDNA from Arabidopsis thaliana."
    Brover V.V., Troukhan M.E., Alexandrov N.A., Lu Y.-P., Flavell R.B., Feldmann K.A.
    Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "Different roles for phytochrome in etiolated and green plants deduced from characterization of Arabidopsis thaliana mutants."
    Chory J., Peto C.A., Ashbaugh M., Saganich R., Pratt L., Ausubel F.
    Plant Cell 1:867-880(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE.
  8. "Phytochrome-deficient hy1 and hy2 long hypocotyl mutants of Arabidopsis are defective in phytochrome chromophore biosynthesis."
    Parks B.M., Quail P.H.
    Plant Cell 3:1177-1186(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.
  9. "Signal transduction mutants of Arabidopsis uncouple nuclear CAB and RBCS gene expression from chloroplast development."
    Susek R.E., Ausubel F.M., Chory J.
    Cell 74:787-799(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.
  10. "Light-stimulated cotyledon expansion in Arabidopsis seedlings (the role of phytochrome b)."
    Neff M.M., Van Volkenburgh E.
    Plant Physiol. 104:1027-1032(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.
  11. "Interactions between hy1 and gun mutants of Arabidopsis, and their implications for plastid/nuclear signalling."
    Vinti G., Hills A., Campbell S., Bowyer J.R., Mochizuki N., Chory J., Lopez-Juez E.
    Plant J. 24:883-894(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.
  12. "Arabidopsis genomes uncoupled 5 (GUN5) mutant reveals the involvement of Mg-chelatase H subunit in plastid-to-nucleus signal transduction."
    Mochizuki N., Brusslan J.A., Larkin R., Nagatani A., Chory J.
    Proc. Natl. Acad. Sci. U.S.A. 98:2053-2058(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  13. "Expression and biochemical properties of a ferredoxin-dependent heme oxygenase required for phytochrome chromophore synthesis."
    Muramoto T., Tsurui N., Terry M.J., Yokota A., Kohchi T.
    Plant Physiol. 130:1958-1966(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES.
  14. "Multiple heme oxygenase family members contribute to the biosynthesis of the phytochrome chromophore in Arabidopsis."
    Emborg T.J., Walker J.M., Noh B., Vierstra R.D.
    Plant Physiol. 140:856-868(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
  15. "Phytochrome chromophore deficiency leads to overproduction of jasmonic acid and elevated expression of jasmonate-responsive genes in Arabidopsis."
    Zhai Q., Li C.B., Zheng W., Wu X., Zhao J., Zhou G., Jiang H., Sun J., Lou Y., Li C.
    Plant Cell Physiol. 48:1061-1071(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION, DISRUPTION PHENOTYPE.
  16. "Characterization of the haem oxygenase protein family in Arabidopsis thaliana reveals a diversity of functions."
    Gisk B., Yasui Y., Kohchi T., Frankenberg-Dinkel N.
    Biochem. J. 425:425-434(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, BIOPHYSICOCHEMICAL PROPERTIES.
  17. "Enzymatic ring opening of an iron corrole by plant-type heme oxygenases: unexpected substrate and protein selectivities."
    Gisk B., Bregier F., Krueger R.A., Broering M., Frankenberg-Dinkel N.
    Biochemistry 49:10042-10044(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, DISRUPTION PHENOTYPE.
  18. "Evidence of Arabidopsis salt acclimation induced by up-regulation of HY1 and the regulatory role of RbohD-derived reactive oxygen species synthesis."
    Xie Y.J., Xu S., Han B., Wu M.Z., Yuan X.X., Han Y., Gu Q., Xu D.K., Yang Q., Shen W.B.
    Plant J. 66:280-292(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.

Entry informationi

Entry nameiHMOX1_ARATH
AccessioniPrimary (citable) accession number: O48782
Secondary accession number(s): B3H4A6, Q7E9A5, Q9FPE3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 27, 2011
Last sequence update: November 1, 1999
Last modified: October 1, 2014
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3