Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O48782

- HMOX1_ARATH

UniProt

O48782 - HMOX1_ARATH

Protein

Heme oxygenase 1, chloroplastic

Gene

HO1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 96 (01 Oct 2014)
      Sequence version 2 (01 Nov 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Key enzyme in the synthesis of the chromophore of the phytochrome family of plant photoreceptors. Catalyzes the opening of the heme ring to form the open-chain tetrapyrrole biliverdin IX with the release of iron and carbon monoxide (CO). Produces specifically the biliverdin IX-alpha isomer. Can form complex with heme, is ferredoxin-dependent and its activity is increased in the presence of ascorbate. Plays a role in salt acclimation signaling. May affect the plastid-to-nucleus signaling pathway by perturbing tetrapyrrole synthesis. The plastid-to-nucleus signal plays an important role in the coordinated expression of both nuclear- and chloroplast-localized genes that encode photosynthesis-related proteins.12 Publications

    Catalytic activityi

    Protoheme + 3 AH2 + 3 O2 = biliverdin + Fe2+ + CO + 3 A + 3 H2O.2 Publications

    Enzyme regulationi

    Activated by ascorbate.1 Publication

    Kineticsi

    1. KM=1.3 µM for hemin2 Publications
    2. KM=1.9 µM for ferredoxin2 Publications
    3. KM=420 µM for ascorbate2 Publications

    pH dependencei

    Optimum pH is 7.2.2 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi86 – 861Iron (heme axial ligand)By similarity

    GO - Molecular functioni

    1. heme binding Source: TAIR
    2. heme oxygenase (decyclizing) activity Source: TAIR
    3. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. carotenoid biosynthetic process Source: TAIR
    2. cellular response to UV-C Source: TAIR
    3. chloroplast-nucleus signaling pathway Source: TAIR
    4. flavonoid biosynthetic process Source: TAIR
    5. heme oxidation Source: InterPro
    6. photosynthesis Source: UniProtKB-KW
    7. phytochromobilin biosynthetic process Source: TAIR
    8. regulation of meristem growth Source: TAIR

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Photosynthesis

    Keywords - Ligandi

    Heme, Iron, Metal-binding

    Enzyme and pathway databases

    BioCyciARA:AT2G26670-MONOMER.
    MetaCyc:AT2G26670-MONOMER.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Heme oxygenase 1, chloroplastic (EC:1.14.99.3)
    Short name:
    AtHO1
    Alternative name(s):
    Protein GENOMES UNCOUPLED 2
    Protein REVERSAL OF THE DET PHENOTYPE 4
    Gene namesi
    Name:HO1
    Synonyms:GUN2, HY1, HY6, TED4
    Ordered Locus Names:At2g26670
    ORF Names:F18A8.4
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 2

    Organism-specific databases

    TAIRiAT2G26670.

    Subcellular locationi

    Plastidchloroplast 2 Publications

    GO - Cellular componenti

    1. chloroplast Source: TAIR

    Keywords - Cellular componenti

    Chloroplast, Plastid

    Pathology & Biotechi

    Disruption phenotypei

    Long hypocotyl, incomplete chloroplast and leaf development, lack of photoreversible phytochromes and lack of phytochromobilin, the phytochrome chromophore. No cotyledon expansion in response to bright-red light. Increased levels of jasmonate (JA) and constitutive expression of JA-inducible defense genes. Increased sensitivity to salt stress and no acclimation response to salinity.11 Publications

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 5454ChloroplastSequence AnalysisAdd
    BLAST
    Chaini55 – 282228Heme oxygenase 1, chloroplasticPRO_0000412185Add
    BLAST

    Proteomic databases

    PRIDEiO48782.

    Expressioni

    Tissue specificityi

    Widely expressed.3 Publications

    Inductioni

    By salt treatment. Down-regulated by jasmonate.2 Publications

    Gene expression databases

    GenevestigatoriO48782.

    Interactioni

    Protein-protein interaction databases

    BioGridi2560. 1 interaction.
    STRINGi3702.AT2G26670.1-P.

    Structurei

    3D structure databases

    ProteinModelPortaliO48782.
    SMRiO48782. Positions 88-277.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the heme oxygenase family.Curated

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiNOG308332.
    HOGENOMiHOG000265822.
    InParanoidiO48782.
    KOiK00510.
    OMAiHTKDQAK.
    PhylomeDBiO48782.

    Family and domain databases

    Gene3Di1.20.910.10. 1 hit.
    InterProiIPR016053. Haem_Oase-like.
    IPR016084. Haem_Oase-like_multi-hlx.
    IPR016951. Haem_Oase_decyc_pln.
    [Graphical view]
    PfamiPF01126. Heme_oxygenase. 1 hit.
    [Graphical view]
    PIRSFiPIRSF030219. Heme_Oase_decyc_pln. 1 hit.
    SUPFAMiSSF48613. SSF48613. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O48782-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAYLAPISSS LSIFKNPQLS RFQFSSSSPN PLFLRPRIQI LSMTMNKSPS    50
    LVVVAATTAA EKQKKRYPGE SKGFVEEMRF VAMRLHTKDQ AKEGEKETKS 100
    IEERPVAKWE PTVEGYLRFL VDSKLVYDTL ELIIQDSNFP TYAEFKNTGL 150
    ERAEKLSTDL EWFKEQGYEI PEPTAPGKTY SQYLKELAEK DPQAFICHFY 200
    NIYFAHSAGG RMIGRKVAER ILDNKELEFY KWDGELSQLL QNVREKLNKV 250
    AEEWTREEKN HCLEETEKSF KYSGEILRLI LS 282
    Length:282
    Mass (Da):32,691
    Last modified:November 1, 1999 - v2
    Checksum:i65D9638890A3E8BA
    GO
    Isoform 2 (identifier: O48782-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         94-142: GEKETKSIEERPVAKWEPTVEGYLRFLVDSKLVYDTLELIIQDSNFPTY → D

    Note: Derived from EST data. No experimental confirmation available.

    Show »
    Length:234
    Mass (Da):27,076
    Checksum:iD5350323BB620A1E
    GO

    Sequence cautioni

    The sequence AAK52998.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei94 – 14249GEKET…NFPTY → D in isoform 2. CuratedVSP_041652Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB021857 Genomic DNA. Translation: BAA77758.1.
    AB021858 mRNA. Translation: BAA77759.1.
    AF132475 Genomic DNA. Translation: AAD22107.1.
    AF132476 Genomic DNA. Translation: AAD22108.1.
    AC003105 Genomic DNA. Translation: AAB95301.2.
    CP002685 Genomic DNA. Translation: AEC07872.1.
    CP002685 Genomic DNA. Translation: AEC07873.1.
    AF327418 mRNA. Translation: AAG42008.2.
    AF375414 mRNA. Translation: AAK52998.1. Different initiation.
    AY129477 mRNA. Translation: AAM91063.1.
    BT002327 mRNA. Translation: AAN86160.1.
    AY087288 mRNA. Translation: AAM64841.1.
    PIRiT52457.
    RefSeqiNP_001118392.1. NM_001124920.1. [O48782-2]
    NP_180235.1. NM_128224.2. [O48782-1]
    UniGeneiAt.23645.

    Genome annotation databases

    EnsemblPlantsiAT2G26670.1; AT2G26670.1; AT2G26670. [O48782-1]
    GeneIDi817208.
    KEGGiath:AT2G26670.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB021857 Genomic DNA. Translation: BAA77758.1 .
    AB021858 mRNA. Translation: BAA77759.1 .
    AF132475 Genomic DNA. Translation: AAD22107.1 .
    AF132476 Genomic DNA. Translation: AAD22108.1 .
    AC003105 Genomic DNA. Translation: AAB95301.2 .
    CP002685 Genomic DNA. Translation: AEC07872.1 .
    CP002685 Genomic DNA. Translation: AEC07873.1 .
    AF327418 mRNA. Translation: AAG42008.2 .
    AF375414 mRNA. Translation: AAK52998.1 . Different initiation.
    AY129477 mRNA. Translation: AAM91063.1 .
    BT002327 mRNA. Translation: AAN86160.1 .
    AY087288 mRNA. Translation: AAM64841.1 .
    PIRi T52457.
    RefSeqi NP_001118392.1. NM_001124920.1. [O48782-2 ]
    NP_180235.1. NM_128224.2. [O48782-1 ]
    UniGenei At.23645.

    3D structure databases

    ProteinModelPortali O48782.
    SMRi O48782. Positions 88-277.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 2560. 1 interaction.
    STRINGi 3702.AT2G26670.1-P.

    Proteomic databases

    PRIDEi O48782.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT2G26670.1 ; AT2G26670.1 ; AT2G26670 . [O48782-1 ]
    GeneIDi 817208.
    KEGGi ath:AT2G26670.

    Organism-specific databases

    TAIRi AT2G26670.

    Phylogenomic databases

    eggNOGi NOG308332.
    HOGENOMi HOG000265822.
    InParanoidi O48782.
    KOi K00510.
    OMAi HTKDQAK.
    PhylomeDBi O48782.

    Enzyme and pathway databases

    BioCyci ARA:AT2G26670-MONOMER.
    MetaCyc:AT2G26670-MONOMER.

    Gene expression databases

    Genevestigatori O48782.

    Family and domain databases

    Gene3Di 1.20.910.10. 1 hit.
    InterProi IPR016053. Haem_Oase-like.
    IPR016084. Haem_Oase-like_multi-hlx.
    IPR016951. Haem_Oase_decyc_pln.
    [Graphical view ]
    Pfami PF01126. Heme_oxygenase. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF030219. Heme_Oase_decyc_pln. 1 hit.
    SUPFAMi SSF48613. SSF48613. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The Arabidopsis photomorphogenic mutant hy1 is deficient in phytochrome chromophore biosynthesis as a result of a mutation in a plastid heme oxygenase."
      Muramoto T., Kohchi T., Yokota A., Hwang I., Goodman H.M.
      Plant Cell 11:335-348(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE.
      Strain: cv. Landsberg erecta.
    2. "The Arabidopsis thaliana HY1 locus, required for phytochrome-chromophore biosynthesis, encodes a protein related to heme oxygenases."
      Davis S.J., Kurepa J., Vierstra R.D.
      Proc. Natl. Acad. Sci. U.S.A. 96:6541-6546(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
      Strain: cv. Columbia and cv. Landsberg erecta.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    4. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    5. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
      Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
      , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
      Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: cv. Columbia.
    6. "Full-length cDNA from Arabidopsis thaliana."
      Brover V.V., Troukhan M.E., Alexandrov N.A., Lu Y.-P., Flavell R.B., Feldmann K.A.
      Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    7. "Different roles for phytochrome in etiolated and green plants deduced from characterization of Arabidopsis thaliana mutants."
      Chory J., Peto C.A., Ashbaugh M., Saganich R., Pratt L., Ausubel F.
      Plant Cell 1:867-880(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISRUPTION PHENOTYPE.
    8. "Phytochrome-deficient hy1 and hy2 long hypocotyl mutants of Arabidopsis are defective in phytochrome chromophore biosynthesis."
      Parks B.M., Quail P.H.
      Plant Cell 3:1177-1186(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE.
    9. "Signal transduction mutants of Arabidopsis uncouple nuclear CAB and RBCS gene expression from chloroplast development."
      Susek R.E., Ausubel F.M., Chory J.
      Cell 74:787-799(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE.
    10. "Light-stimulated cotyledon expansion in Arabidopsis seedlings (the role of phytochrome b)."
      Neff M.M., Van Volkenburgh E.
      Plant Physiol. 104:1027-1032(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE.
    11. "Interactions between hy1 and gun mutants of Arabidopsis, and their implications for plastid/nuclear signalling."
      Vinti G., Hills A., Campbell S., Bowyer J.R., Mochizuki N., Chory J., Lopez-Juez E.
      Plant J. 24:883-894(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE.
    12. "Arabidopsis genomes uncoupled 5 (GUN5) mutant reveals the involvement of Mg-chelatase H subunit in plastid-to-nucleus signal transduction."
      Mochizuki N., Brusslan J.A., Larkin R., Nagatani A., Chory J.
      Proc. Natl. Acad. Sci. U.S.A. 98:2053-2058(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    13. "Expression and biochemical properties of a ferredoxin-dependent heme oxygenase required for phytochrome chromophore synthesis."
      Muramoto T., Tsurui N., Terry M.J., Yokota A., Kohchi T.
      Plant Physiol. 130:1958-1966(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES.
    14. "Multiple heme oxygenase family members contribute to the biosynthesis of the phytochrome chromophore in Arabidopsis."
      Emborg T.J., Walker J.M., Noh B., Vierstra R.D.
      Plant Physiol. 140:856-868(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
    15. "Phytochrome chromophore deficiency leads to overproduction of jasmonic acid and elevated expression of jasmonate-responsive genes in Arabidopsis."
      Zhai Q., Li C.B., Zheng W., Wu X., Zhao J., Zhou G., Jiang H., Sun J., Lou Y., Li C.
      Plant Cell Physiol. 48:1061-1071(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION, DISRUPTION PHENOTYPE.
    16. "Characterization of the haem oxygenase protein family in Arabidopsis thaliana reveals a diversity of functions."
      Gisk B., Yasui Y., Kohchi T., Frankenberg-Dinkel N.
      Biochem. J. 425:425-434(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, BIOPHYSICOCHEMICAL PROPERTIES.
    17. "Enzymatic ring opening of an iron corrole by plant-type heme oxygenases: unexpected substrate and protein selectivities."
      Gisk B., Bregier F., Krueger R.A., Broering M., Frankenberg-Dinkel N.
      Biochemistry 49:10042-10044(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, DISRUPTION PHENOTYPE.
    18. "Evidence of Arabidopsis salt acclimation induced by up-regulation of HY1 and the regulatory role of RbohD-derived reactive oxygen species synthesis."
      Xie Y.J., Xu S., Han B., Wu M.Z., Yuan X.X., Han Y., Gu Q., Xu D.K., Yang Q., Shen W.B.
      Plant J. 66:280-292(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE.

    Entry informationi

    Entry nameiHMOX1_ARATH
    AccessioniPrimary (citable) accession number: O48782
    Secondary accession number(s): B3H4A6, Q7E9A5, Q9FPE3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 27, 2011
    Last sequence update: November 1, 1999
    Last modified: October 1, 2014
    This is version 96 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3