O48782 (HMOX1_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Heme oxygenase 1, chloroplastic Short name=AtHO1 EC=1.14.99.3 Alternative name(s): Protein GENOMES UNCOUPLED 2 Protein REVERSAL OF THE DET PHENOTYPE 4 | ||||||||
| Gene names |
| ||||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 282 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Key enzyme in the synthesis of the chromophore of the phytochrome family of plant photoreceptors. Catalyzes the opening of the heme ring to form the open-chain tetrapyrrole biliverdin IX with the release of iron and carbon monoxide (CO). Produces specifically the biliverdin IX-alpha isomer. Can form complex with heme, is ferredoxin-dependent and its activity is increased in the presence of ascorbate. Plays a role in salt acclimation signaling. May affect the plastid-to-nucleus signaling pathway by perturbing tetrapyrrole synthesis. The plastid-to-nucleus signal plays an important role in the coordinated expression of both nuclear- and chloroplast-localized genes that encode photosynthesis-related proteins. Ref.1 Ref.2 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.16 Ref.17 Ref.18 |
| Catalytic activity | Heme + 3 AH2 + 3 O2 = biliverdin + Fe2+ + CO + 3 A + 3 H2O. Ref.1 Ref.13 |
| Enzyme regulation | Activated by ascorbate. Ref.13 |
| Subcellular location | |
| Tissue specificity | |
| Induction | By salt treatment. Down-regulated by jasmonate. Ref.13 Ref.15 Ref.17 |
| Disruption phenotype | Long hypocotyl, incomplete chloroplast and leaf development, lack of photoreversible phytochromes and lack of phytochromobilin, the phytochrome chromophore. No cotyledon expansion in response to bright-red light. Increased levels of jasmonate (JA) and constitutive expression of JA-inducible defense genes. Increased sensitivity to salt stress and no acclimation response to salinity. Ref.1 Ref.2 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.14 Ref.15 Ref.17 Ref.18 |
| Sequence similarities | Belongs to the heme oxygenase family. |
| Biophysicochemical properties | Kinetic parameters: KM=1.3 µM for hemin Ref.13 Ref.16 KM=1.9 µM for ferredoxin KM=420 µM for ascorbate pH dependence: Optimum pH is 7.2. |
| Sequence caution | The sequence AAK52998.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O48782-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O48782-2) The sequence of this isoform differs from the canonical sequence as follows: 94-142: GEKETKSIEERPVAKWEPTVEGYLRFLVDSKLVYDTLELIIQDSNFPTY → D | ||||||
| Note: Derived from EST data. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 54 | 54 | Chloroplast Potential | ||||||
| Chain | 55 – 282 | 228 | Heme oxygenase 1, chloroplastic | PRO_0000412185 | |||||
Sites | |||||||||
| Metal binding | 86 | 1 | Iron (heme axial ligand) By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 94 – 142 | 49 | GEKET…NFPTY → D in isoform 2. | VSP_041652 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The Arabidopsis photomorphogenic mutant hy1 is deficient in phytochrome chromophore biosynthesis as a result of a mutation in a plastid heme oxygenase." Muramoto T., Kohchi T., Yokota A., Hwang I., Goodman H.M. Plant Cell 11:335-348(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE. Strain: cv. Landsberg erecta. |
| [2] | "The Arabidopsis thaliana HY1 locus, required for phytochrome-chromophore biosynthesis, encodes a protein related to heme oxygenases." Davis S.J., Kurepa J., Vierstra R.D. Proc. Natl. Acad. Sci. U.S.A. 96:6541-6546(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. Strain: cv. Columbia and cv. Landsberg erecta. |
| [3] | "Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana." Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D., Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V., Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L., Moffat K.S., Cronin L.A. Venter J.C.Nature 402:761-768(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [4] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [5] | "Empirical analysis of transcriptional activity in the Arabidopsis genome." Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R.Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: cv. Columbia. |
| [6] | "Full-length cDNA from Arabidopsis thaliana." Brover V.V., Troukhan M.E., Alexandrov N.A., Lu Y.-P., Flavell R.B., Feldmann K.A. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "Different roles for phytochrome in etiolated and green plants deduced from characterization of Arabidopsis thaliana mutants." Chory J., Peto C.A., Ashbaugh M., Saganich R., Pratt L., Ausubel F. Plant Cell 1:867-880(1989) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE. |
| [8] | "Phytochrome-deficient hy1 and hy2 long hypocotyl mutants of Arabidopsis are defective in phytochrome chromophore biosynthesis." Parks B.M., Quail P.H. Plant Cell 3:1177-1186(1991) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [9] | "Signal transduction mutants of Arabidopsis uncouple nuclear CAB and RBCS gene expression from chloroplast development." Susek R.E., Ausubel F.M., Chory J. Cell 74:787-799(1993) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [10] | "Light-stimulated cotyledon expansion in Arabidopsis seedlings (the role of phytochrome b)." Neff M.M., Van Volkenburgh E. Plant Physiol. 104:1027-1032(1994) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [11] | "Interactions between hy1 and gun mutants of Arabidopsis, and their implications for plastid/nuclear signalling." Vinti G., Hills A., Campbell S., Bowyer J.R., Mochizuki N., Chory J., Lopez-Juez E. Plant J. 24:883-894(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [12] | "Arabidopsis genomes uncoupled 5 (GUN5) mutant reveals the involvement of Mg-chelatase H subunit in plastid-to-nucleus signal transduction." Mochizuki N., Brusslan J.A., Larkin R., Nagatani A., Chory J. Proc. Natl. Acad. Sci. U.S.A. 98:2053-2058(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "Expression and biochemical properties of a ferredoxin-dependent heme oxygenase required for phytochrome chromophore synthesis." Muramoto T., Tsurui N., Terry M.J., Yokota A., Kohchi T. Plant Physiol. 130:1958-1966(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES. |
| [14] | "Multiple heme oxygenase family members contribute to the biosynthesis of the phytochrome chromophore in Arabidopsis." Emborg T.J., Walker J.M., Noh B., Vierstra R.D. Plant Physiol. 140:856-868(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. |
| [15] | "Phytochrome chromophore deficiency leads to overproduction of jasmonic acid and elevated expression of jasmonate-responsive genes in Arabidopsis." Zhai Q., Li C.B., Zheng W., Wu X., Zhao J., Zhou G., Jiang H., Sun J., Lou Y., Li C. Plant Cell Physiol. 48:1061-1071(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION, DISRUPTION PHENOTYPE. |
| [16] | "Characterization of the haem oxygenase protein family in Arabidopsis thaliana reveals a diversity of functions." Gisk B., Yasui Y., Kohchi T., Frankenberg-Dinkel N. Biochem. J. 425:425-434(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, BIOPHYSICOCHEMICAL PROPERTIES. |
| [17] | "Enzymatic ring opening of an iron corrole by plant-type heme oxygenases: unexpected substrate and protein selectivities." Gisk B., Bregier F., Krueger R.A., Broering M., Frankenberg-Dinkel N. Biochemistry 49:10042-10044(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, DISRUPTION PHENOTYPE. |
| [18] | "Evidence of Arabidopsis salt acclimation induced by up-regulation of HY1 and the regulatory role of RbohD-derived reactive oxygen species synthesis." Xie Y.J., Xu S., Han B., Wu M.Z., Yuan X.X., Han Y., Gu Q., Xu D.K., Yang Q., Shen W.B. Plant J. 66:280-292(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB021857 Genomic DNA. Translation: BAA77758.1. AB021858 mRNA. Translation: BAA77759.1. AF132475 Genomic DNA. Translation: AAD22107.1. AF132476 Genomic DNA. Translation: AAD22108.1. AC003105 Genomic DNA. Translation: AAB95301.2. CP002685 Genomic DNA. Translation: AEC07872.1. CP002685 Genomic DNA. Translation: AEC07873.1. AF327418 mRNA. Translation: AAG42008.2. AF375414 mRNA. Translation: AAK52998.1. Different initiation. AY129477 mRNA. Translation: AAM91063.1. BT002327 mRNA. Translation: AAN86160.1. AY087288 mRNA. Translation: AAM64841.1. |
| IPI | IPI00531937. IPI00891372. |
| PIR | T52457. |
| RefSeq | NP_001118392.1. NM_001124920.1. NP_180235.1. NM_128224.2. |
| UniGene | At.23645. |
3D structure databases | |
| ProteinModelPortal | O48782. |
| SMR | O48782. Positions 88-277. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 3702.AT2G26670.1-P. |
Proteomic databases | |
| PRIDE | O48782. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 817208. |
| KEGG | ath:AT2G26670. |
Organism-specific databases | |
| TAIR | At2g26670. |
Phylogenomic databases | |
| eggNOG | NOG308332. |
| HOGENOM | HOG000265822. |
| InParanoid | O48782. |
| OMA | GGRMIGR. |
| PhylomeDB | O48782. |
| ProtClustDB | CLSN2683416. |
Gene expression databases | |
| Genevestigator | O48782. |
Family and domain databases | |
| Gene3D | 1.20.910.10. 1 hit. |
| InterPro | IPR016053. Haem_Oase-like. IPR016084. Haem_Oase-like_multi-hlx. IPR016951. Haem_Oase_decyc_pln. [Graphical view] |
| Pfam | PF01126. Heme_oxygenase. 1 hit. [Graphical view] |
| PIRSF | PIRSF030219. Heme_Oase_decyc_pln. 1 hit. |
| SUPFAM | SSF48613. Heme_oxygenase. 1 hit. |
| ProtoNet | Search... |
Entry information
| Entry name | HMOX1_ARATH | ||||||||
| Accession | Primary (citable) accession number: O48782 Secondary accession number(s): B3H4A6, Q7E9A5, Q9FPE3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with
