Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prickle-like protein 3

Gene

PRICKLE3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. zinc ion binding Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

SignaLinkiO43900.

Names & Taxonomyi

Protein namesi
Recommended name:
Prickle-like protein 3
Alternative name(s):
LIM domain only protein 6
Short name:
LMO-6
Triple LIM domain protein 6
Gene namesi
Name:PRICKLE3
Synonyms:LMO6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:6645. PRICKLE3.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162400060.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 615615Prickle-like protein 3PRO_0000075822Add
BLAST

Proteomic databases

MaxQBiO43900.
PaxDbiO43900.
PRIDEiO43900.

PTM databases

PhosphoSiteiO43900.

Expressioni

Tissue specificityi

Widely expressed.

Gene expression databases

BgeeiO43900.
CleanExiHS_PRICKLE3.
ExpressionAtlasiO43900. baseline and differential.
GenevestigatoriO43900.

Organism-specific databases

HPAiHPA000998.
HPA001442.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ABL1P005192EBI-1751761,EBI-375543
FYNP062412EBI-1751761,EBI-515315

Protein-protein interaction databases

BioGridi110192. 6 interactions.
IntActiO43900. 10 interactions.
MINTiMINT-6772012.
STRINGi9606.ENSP00000365494.

Structurei

3D structure databases

ProteinModelPortaliO43900.
SMRiO43900. Positions 248-366.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini74 – 182109PETPROSITE-ProRule annotationAdd
BLAST
Domaini184 – 24966LIM zinc-binding 1PROSITE-ProRule annotationAdd
BLAST
Domaini250 – 30960LIM zinc-binding 2PROSITE-ProRule annotationAdd
BLAST
Domaini310 – 37364LIM zinc-binding 3PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi150 – 1534Poly-Glu
Compositional biasi513 – 52210Poly-His
Compositional biasi544 – 55714Poly-SerAdd
BLAST

Sequence similaritiesi

Belongs to the prickle / espinas / testin family.Curated
Contains 3 LIM zinc-binding domains.PROSITE-ProRule annotation
Contains 1 PET domain.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiNOG314122.
GeneTreeiENSGT00550000074438.
HOGENOMiHOG000115694.
HOVERGENiHBG106338.
InParanoidiO43900.
OMAiDGAFGRQ.
OrthoDBiEOG7P8P7M.
PhylomeDBiO43900.
TreeFamiTF313265.

Family and domain databases

Gene3Di2.10.110.10. 3 hits.
InterProiIPR010442. PET_domain.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 3 hits.
PF06297. PET. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 3 hits.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 3 hits.
PS51303. PET. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43900-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFARGSRRRR SGRAPPEAED PDRGQPCNSC REQCPGFLLH GWRKICQHCK
60 70 80 90 100
CPREEHAVHA VPVDLERIMC RLISDFQRHS ISDDDSGCAS EEYAWVPPGL
110 120 130 140 150
KPEQVYQFFS CLPEDKVPYV NSPGEKYRIK QLLHQLPPHD SEAQYCTALE
160 170 180 190 200
EEEKKELRAF SQQRKRENLG RGIVRIFPVT ITGAICEECG KQIGGGDIAV
210 220 230 240 250
FASRAGLGAC WHPQCFVCTT CQELLVDLIY FYHVGKVYCG RHHAECLRPR
260 270 280 290 300
CQACDEIIFS PECTEAEGRH WHMDHFCCFE CEASLGGQRY VMRQSRPHCC
310 320 330 340 350
ACYEARHAEY CDGCGEHIGL DQGQMAYEGQ HWHASDRCFC CSRCGRALLG
360 370 380 390 400
RPFLPRRGLI FCSRACSLGS EPTAPGPSRR SWSAGPVTAP LAASTASFSA
410 420 430 440 450
VKGASETTTK GTSTELAPAT GPEEPSRFLR GAPHRHSMPE LGLRSVPEPP
460 470 480 490 500
PESPGQPNLR PDDSAFGRQS TPRVSFRDPL VSEGGPRRTL SAPPAQRRRP
510 520 530 540 550
RSPPPRAPSR RRHHHHNHHH HHNRHPSRRR HYQCDAGSGS DSESCSSSPS
560 570 580 590 600
SSSSESSEDD GFFLGERIPL PPHLCRPMPA QDTAMETFNS PSLSLPRDSR
610
AGMPRQARDK NCIVA
Length:615
Mass (Da):68,609
Last modified:August 2, 2002 - v2
Checksum:iCD024365C072B052
GO
Isoform 2 (identifier: O43900-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     106-142: YQFFSCLPEDKVPYVNSPGEKYRIKQLLHQLPPHDSE → TRGQPSTLAVQWVHTNAHTHTHTQ

Note: No experimental confirmation available.

Show »
Length:534
Mass (Da):59,097
Checksum:i7C2E745AEE1897E8
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti185 – 1851I → S in AAB92357 (PubMed:9344658).Curated
Sequence conflicti370 – 509140Missing in AAB92357 (PubMed:9344658).CuratedAdd
BLAST

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti343 – 3431R → C.
Corresponds to variant rs7065449 [ dbSNP | Ensembl ].
VAR_050169
Natural varianti558 – 5581E → D in a breast cancer sample; somatic mutation. 1 Publication
VAR_036188

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6868Missing in isoform 2. 1 PublicationVSP_056568Add
BLAST
Alternative sequencei106 – 14237YQFFS…PHDSE → TRGQPSTLAVQWVHTNAHTH THTQ in isoform 2. 1 PublicationVSP_056569Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ011654 mRNA. Translation: CAA09726.1.
BT007423 mRNA. Translation: AAP36091.1.
AK303308 mRNA. Translation: BAH13938.1.
AF196779 Genomic DNA. No translation available.
CH471224 Genomic DNA. Translation: EAW50686.1.
BC002468 mRNA. Translation: AAH02468.1.
BC016856 mRNA. Translation: AAH16856.1.
U93305 Genomic DNA. Translation: AAB92357.1.
CCDSiCCDS14320.1. [O43900-1]
RefSeqiNP_006141.2. NM_006150.3. [O43900-1]
UniGeneiHs.732712.

Genome annotation databases

EnsembliENST00000599218; ENSP00000470248; ENSG00000012211. [O43900-1]
GeneIDi4007.
KEGGihsa:4007.
UCSCiuc004dmy.1. human. [O43900-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ011654 mRNA. Translation: CAA09726.1.
BT007423 mRNA. Translation: AAP36091.1.
AK303308 mRNA. Translation: BAH13938.1.
AF196779 Genomic DNA. No translation available.
CH471224 Genomic DNA. Translation: EAW50686.1.
BC002468 mRNA. Translation: AAH02468.1.
BC016856 mRNA. Translation: AAH16856.1.
U93305 Genomic DNA. Translation: AAB92357.1.
CCDSiCCDS14320.1. [O43900-1]
RefSeqiNP_006141.2. NM_006150.3. [O43900-1]
UniGeneiHs.732712.

3D structure databases

ProteinModelPortaliO43900.
SMRiO43900. Positions 248-366.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110192. 6 interactions.
IntActiO43900. 10 interactions.
MINTiMINT-6772012.
STRINGi9606.ENSP00000365494.

PTM databases

PhosphoSiteiO43900.

Proteomic databases

MaxQBiO43900.
PaxDbiO43900.
PRIDEiO43900.

Protocols and materials databases

DNASUi4007.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000599218; ENSP00000470248; ENSG00000012211. [O43900-1]
GeneIDi4007.
KEGGihsa:4007.
UCSCiuc004dmy.1. human. [O43900-1]

Organism-specific databases

CTDi4007.
GeneCardsiGC0XM049031.
HGNCiHGNC:6645. PRICKLE3.
HPAiHPA000998.
HPA001442.
MIMi300111. gene.
neXtProtiNX_O43900.
PharmGKBiPA162400060.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG314122.
GeneTreeiENSGT00550000074438.
HOGENOMiHOG000115694.
HOVERGENiHBG106338.
InParanoidiO43900.
OMAiDGAFGRQ.
OrthoDBiEOG7P8P7M.
PhylomeDBiO43900.
TreeFamiTF313265.

Enzyme and pathway databases

SignaLinkiO43900.

Miscellaneous databases

ChiTaRSiPRICKLE3. human.
GenomeRNAii4007.
NextBioi15716.
PROiO43900.
SOURCEiSearch...

Gene expression databases

BgeeiO43900.
CleanExiHS_PRICKLE3.
ExpressionAtlasiO43900. baseline and differential.
GenevestigatoriO43900.

Family and domain databases

Gene3Di2.10.110.10. 3 hits.
InterProiIPR010442. PET_domain.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 3 hits.
PF06297. PET. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 3 hits.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 3 hits.
PS51303. PET. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Transcription map in Xp11.23."
    Strom T.M., Gutwillinger N., Nyakatura G., Hellebrand H., Drescher B., Rosenthal A., Meindl A.
    Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Heart.
  2. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Thymus.
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon and Kidney.
  7. "Sequence-based exon prediction around the synaptophysin locus reveals a gene-rich area containing novel genes in human proximal Xp."
    Fisher S.E., Ciccodicola A., Tanaka K., Curci A., Desicato S., D'Urso M., Craig I.W.
    Genomics 45:340-347(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 69-615.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: VARIANT [LARGE SCALE ANALYSIS] ASP-558.

Entry informationi

Entry nameiPRIC3_HUMAN
AccessioniPrimary (citable) accession number: O43900
Secondary accession number(s): B7Z8F2, O76007, Q53XR5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: August 2, 2002
Last modified: February 4, 2015
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.