Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O43900

- PRIC3_HUMAN

UniProt

O43900 - PRIC3_HUMAN

Protein

Prickle-like protein 3

Gene

PRICKLE3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 127 (01 Oct 2014)
      Sequence version 2 (02 Aug 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. zinc ion binding Source: InterPro

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    SignaLinkiO43900.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Prickle-like protein 3
    Alternative name(s):
    LIM domain only protein 6
    Short name:
    LMO-6
    Triple LIM domain protein 6
    Gene namesi
    Name:PRICKLE3
    Synonyms:LMO6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:6645. PRICKLE3.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162400060.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 615615Prickle-like protein 3PRO_0000075822Add
    BLAST

    Proteomic databases

    MaxQBiO43900.
    PaxDbiO43900.
    PRIDEiO43900.

    PTM databases

    PhosphoSiteiO43900.

    Expressioni

    Tissue specificityi

    Widely expressed.

    Gene expression databases

    ArrayExpressiO43900.
    BgeeiO43900.
    CleanExiHS_PRICKLE3.
    GenevestigatoriO43900.

    Organism-specific databases

    HPAiHPA000998.
    HPA001442.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ABL1P005192EBI-1751761,EBI-375543
    FYNP062412EBI-1751761,EBI-515315

    Protein-protein interaction databases

    BioGridi110192. 4 interactions.
    IntActiO43900. 10 interactions.
    MINTiMINT-6772012.
    STRINGi9606.ENSP00000365494.

    Structurei

    3D structure databases

    ProteinModelPortaliO43900.
    SMRiO43900. Positions 182-366.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini74 – 182109PETPROSITE-ProRule annotationAdd
    BLAST
    Domaini184 – 24966LIM zinc-binding 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini250 – 30960LIM zinc-binding 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini310 – 37364LIM zinc-binding 3PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi150 – 1534Poly-Glu
    Compositional biasi513 – 52210Poly-His
    Compositional biasi544 – 55714Poly-SerAdd
    BLAST

    Sequence similaritiesi

    Belongs to the prickle / espinas / testin family.Curated
    Contains 3 LIM zinc-binding domains.PROSITE-ProRule annotation
    Contains 1 PET domain.PROSITE-ProRule annotation

    Keywords - Domaini

    LIM domain, Repeat

    Phylogenomic databases

    eggNOGiNOG314122.
    HOGENOMiHOG000115694.
    HOVERGENiHBG106338.
    InParanoidiO43900.
    OMAiQCFVCST.
    OrthoDBiEOG7P8P7M.
    PhylomeDBiO43900.
    TreeFamiTF313265.

    Family and domain databases

    Gene3Di2.10.110.10. 3 hits.
    InterProiIPR010442. PET_domain.
    IPR001781. Znf_LIM.
    [Graphical view]
    PfamiPF00412. LIM. 3 hits.
    PF06297. PET. 1 hit.
    [Graphical view]
    SMARTiSM00132. LIM. 3 hits.
    [Graphical view]
    PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 3 hits.
    PS51303. PET. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O43900-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFARGSRRRR SGRAPPEAED PDRGQPCNSC REQCPGFLLH GWRKICQHCK    50
    CPREEHAVHA VPVDLERIMC RLISDFQRHS ISDDDSGCAS EEYAWVPPGL 100
    KPEQVYQFFS CLPEDKVPYV NSPGEKYRIK QLLHQLPPHD SEAQYCTALE 150
    EEEKKELRAF SQQRKRENLG RGIVRIFPVT ITGAICEECG KQIGGGDIAV 200
    FASRAGLGAC WHPQCFVCTT CQELLVDLIY FYHVGKVYCG RHHAECLRPR 250
    CQACDEIIFS PECTEAEGRH WHMDHFCCFE CEASLGGQRY VMRQSRPHCC 300
    ACYEARHAEY CDGCGEHIGL DQGQMAYEGQ HWHASDRCFC CSRCGRALLG 350
    RPFLPRRGLI FCSRACSLGS EPTAPGPSRR SWSAGPVTAP LAASTASFSA 400
    VKGASETTTK GTSTELAPAT GPEEPSRFLR GAPHRHSMPE LGLRSVPEPP 450
    PESPGQPNLR PDDSAFGRQS TPRVSFRDPL VSEGGPRRTL SAPPAQRRRP 500
    RSPPPRAPSR RRHHHHNHHH HHNRHPSRRR HYQCDAGSGS DSESCSSSPS 550
    SSSSESSEDD GFFLGERIPL PPHLCRPMPA QDTAMETFNS PSLSLPRDSR 600
    AGMPRQARDK NCIVA 615
    Length:615
    Mass (Da):68,609
    Last modified:August 2, 2002 - v2
    Checksum:iCD024365C072B052
    GO
    Isoform 2 (identifier: O43900-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-68: Missing.
         106-142: YQFFSCLPEDKVPYVNSPGEKYRIKQLLHQLPPHDSE → TRGQPSTLAVQWVHTNAHTHTHTQ

    Note: No experimental confirmation available.

    Show »
    Length:534
    Mass (Da):59,097
    Checksum:i7C2E745AEE1897E8
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti185 – 1851I → S in AAB92357. (PubMed:9344658)Curated
    Sequence conflicti370 – 509140Missing in AAB92357. (PubMed:9344658)CuratedAdd
    BLAST

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti343 – 3431R → C.
    Corresponds to variant rs7065449 [ dbSNP | Ensembl ].
    VAR_050169
    Natural varianti558 – 5581E → D in a breast cancer sample; somatic mutation. 1 Publication
    VAR_036188

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6868Missing in isoform 2. 1 PublicationVSP_056568Add
    BLAST
    Alternative sequencei106 – 14237YQFFS…PHDSE → TRGQPSTLAVQWVHTNAHTH THTQ in isoform 2. 1 PublicationVSP_056569Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ011654 mRNA. Translation: CAA09726.1.
    BT007423 mRNA. Translation: AAP36091.1.
    AK303308 mRNA. Translation: BAH13938.1.
    AF196779 Genomic DNA. No translation available.
    CH471224 Genomic DNA. Translation: EAW50686.1.
    BC002468 mRNA. Translation: AAH02468.1.
    BC016856 mRNA. Translation: AAH16856.1.
    U93305 Genomic DNA. Translation: AAB92357.1.
    CCDSiCCDS14320.1.
    RefSeqiNP_006141.2. NM_006150.3.
    UniGeneiHs.732712.

    Genome annotation databases

    EnsembliENST00000376317; ENSP00000365494; ENSG00000012211.
    ENST00000536904; ENSP00000441385; ENSG00000012211.
    ENST00000599218; ENSP00000470248; ENSG00000012211.
    GeneIDi4007.
    KEGGihsa:4007.
    UCSCiuc004dmy.1. human.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ011654 mRNA. Translation: CAA09726.1 .
    BT007423 mRNA. Translation: AAP36091.1 .
    AK303308 mRNA. Translation: BAH13938.1 .
    AF196779 Genomic DNA. No translation available.
    CH471224 Genomic DNA. Translation: EAW50686.1 .
    BC002468 mRNA. Translation: AAH02468.1 .
    BC016856 mRNA. Translation: AAH16856.1 .
    U93305 Genomic DNA. Translation: AAB92357.1 .
    CCDSi CCDS14320.1.
    RefSeqi NP_006141.2. NM_006150.3.
    UniGenei Hs.732712.

    3D structure databases

    ProteinModelPortali O43900.
    SMRi O43900. Positions 182-366.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110192. 4 interactions.
    IntActi O43900. 10 interactions.
    MINTi MINT-6772012.
    STRINGi 9606.ENSP00000365494.

    PTM databases

    PhosphoSitei O43900.

    Proteomic databases

    MaxQBi O43900.
    PaxDbi O43900.
    PRIDEi O43900.

    Protocols and materials databases

    DNASUi 4007.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000376317 ; ENSP00000365494 ; ENSG00000012211 .
    ENST00000536904 ; ENSP00000441385 ; ENSG00000012211 .
    ENST00000599218 ; ENSP00000470248 ; ENSG00000012211 .
    GeneIDi 4007.
    KEGGi hsa:4007.
    UCSCi uc004dmy.1. human.

    Organism-specific databases

    CTDi 4007.
    GeneCardsi GC0XM049031.
    HGNCi HGNC:6645. PRICKLE3.
    HPAi HPA000998.
    HPA001442.
    MIMi 300111. gene.
    neXtProti NX_O43900.
    PharmGKBi PA162400060.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG314122.
    HOGENOMi HOG000115694.
    HOVERGENi HBG106338.
    InParanoidi O43900.
    OMAi QCFVCST.
    OrthoDBi EOG7P8P7M.
    PhylomeDBi O43900.
    TreeFami TF313265.

    Enzyme and pathway databases

    SignaLinki O43900.

    Miscellaneous databases

    GenomeRNAii 4007.
    NextBioi 15716.
    PROi O43900.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O43900.
    Bgeei O43900.
    CleanExi HS_PRICKLE3.
    Genevestigatori O43900.

    Family and domain databases

    Gene3Di 2.10.110.10. 3 hits.
    InterProi IPR010442. PET_domain.
    IPR001781. Znf_LIM.
    [Graphical view ]
    Pfami PF00412. LIM. 3 hits.
    PF06297. PET. 1 hit.
    [Graphical view ]
    SMARTi SM00132. LIM. 3 hits.
    [Graphical view ]
    PROSITEi PS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 3 hits.
    PS51303. PET. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Transcription map in Xp11.23."
      Strom T.M., Gutwillinger N., Nyakatura G., Hellebrand H., Drescher B., Rosenthal A., Meindl A.
      Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Heart.
    2. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Thymus.
    4. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon and Kidney.
    7. "Sequence-based exon prediction around the synaptophysin locus reveals a gene-rich area containing novel genes in human proximal Xp."
      Fisher S.E., Ciccodicola A., Tanaka K., Curci A., Desicato S., D'Urso M., Craig I.W.
      Genomics 45:340-347(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 69-615.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: VARIANT [LARGE SCALE ANALYSIS] ASP-558.

    Entry informationi

    Entry nameiPRIC3_HUMAN
    AccessioniPrimary (citable) accession number: O43900
    Secondary accession number(s): B7Z8F2, O76007, Q53XR5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 15, 1998
    Last sequence update: August 2, 2002
    Last modified: October 1, 2014
    This is version 127 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3