SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O43847

- NRDC_HUMAN

UniProt

O43847 - NRDC_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nardilysin

Gene
NRD1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Catalytic activityi

Hydrolysis of polypeptides, preferably at -Xaa-|-Arg-Lys-, and less commonly at -Arg-|-Arg-Xaa-, in which Xaa is not Arg or Lys.

Cofactori

Binds 1 zinc ion per subunit By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi232 – 2321Zinc By similarity
Active sitei235 – 2351Proton acceptor By similarity
Metal bindingi236 – 2361Zinc By similarity
Metal bindingi313 – 3131Zinc By similarity

GO - Molecular functioni

  1. epidermal growth factor binding Source: UniProtKB
  2. metal ion binding Source: UniProtKB-KW
  3. metalloendopeptidase activity Source: UniProtKB
  4. protein binding Source: IntAct

GO - Biological processi

  1. cell migration Source: UniProtKB
  2. cell proliferation Source: UniProtKB
  3. neuromuscular junction development Source: ProtInc
  4. positive regulation of membrane protein ectodomain proteolysis Source: BHF-UCL
  5. proteolysis Source: UniProtKB
  6. regulation of endopeptidase activity Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BRENDAi3.4.24.61. 2681.
SignaLinkiO43847.

Protein family/group databases

MEROPSiM16.005.

Names & Taxonomyi

Protein namesi
Recommended name:
Nardilysin (EC:3.4.24.61)
Alternative name(s):
N-arginine dibasic convertase
Short name:
NRD convertase
Short name:
NRD-C
Gene namesi
Name:NRD1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:7995. NRD1.

Subcellular locationi

GO - Cellular componenti

  1. cell surface Source: UniProtKB
  2. cytosol Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31774.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020 Reviewed predictionAdd
BLAST
Chaini21 – 11501130NardilysinPRO_0000026755Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei86 – 861Phosphoserine By similarity
Modified residuei94 – 941Phosphoserine4 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO43847.
PaxDbiO43847.
PRIDEiO43847.

PTM databases

PhosphoSiteiO43847.

Expressioni

Tissue specificityi

Primarily in adult heart, skeletal muscle, and testis and at much lower levels in other tissues.

Gene expression databases

ArrayExpressiO43847.
BgeeiO43847.
CleanExiHS_NRD1.
GenevestigatoriO43847.

Organism-specific databases

HPAiHPA023679.
HPA053661.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TP53P046376EBI-2371631,EBI-366083

Protein-protein interaction databases

BioGridi110954. 38 interactions.
IntActiO43847. 7 interactions.
STRINGi9606.ENSP00000346890.

Structurei

3D structure databases

ProteinModelPortaliO43847.
SMRiO43847. Positions 206-1088.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi142 – 20059Asp/Glu-rich (highly acidic)Add
BLAST
Compositional biasi144 – 15310Poly-Glu

Sequence similaritiesi

Belongs to the peptidase M16 family.

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG1025.
HOVERGENiHBG006530.
KOiK01411.
OrthoDBiEOG7HHWRD.
PhylomeDBiO43847.

Family and domain databases

Gene3Di3.30.830.10. 5 hits.
InterProiIPR011249. Metalloenz_LuxS/M16.
IPR011237. Pept_M16_dom.
IPR011765. Pept_M16_N.
IPR001431. Pept_M16_Zn_BS.
IPR007863. Peptidase_M16_C.
[Graphical view]
PfamiPF00675. Peptidase_M16. 1 hit.
PF05193. Peptidase_M16_C. 2 hits.
[Graphical view]
SUPFAMiSSF63411. SSF63411. 5 hits.
PROSITEiPS00143. INSULINASE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O43847-1) [UniParc]FASTAAdd to Basket

Also known as: NRD1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLRRVTVAAV CATRRKLCEA GRELAALWGI ETRGRCEDSA AARPFPILAM     50
PGRNKAKSTC SCPDLQPNGQ DLGENSRVAR LGADESEEEG RRGSLSNAGD 100
PEIVKSPSDP KQYRYIKLQN GLQALLISDL SNMEGKTGNT TDDEEEEEVE 150
EEEDDDEDSG AEIEDDDEEG FDDEDEFDDE HDDDLDTEDN ELEELEERAE 200
ARKKTTEKQS AAALCVGVGS FADPDDLPGL AHFLEHMVFM GSLKYPDENG 250
FDAFLKKHGG SDNASTDCER TVFQFDVQRK YFKEALDRWA QFFIHPLMIR 300
DAIDREVEAV DSEYQLARPS DANRKEMLFG SLARPGHPMG KFFWGNAETL 350
KHEPRKNNID THARLREFWM RYYSSHYMTL VVQSKETLDT LEKWVTEIFS 400
QIPNNGLPRP NFGHLTDPFD TPAFNKLYRV VPIRKIHALT ITWALPPQQQ 450
HYRVKPLHYI SWLVGHEGKG SILSFLRKKC WALALFGGNG ETGFEQNSTY 500
SVFSISITLT DEGYEHFYEV AYTVFQYLKM LQKLGPEKRI FEEIRKIEDN 550
EFHYQEQTDP VEYVENMCEN MQLYPLQDIL TGDQLLFEYK PEVIGEALNQ 600
LVPQKANLVL LSGANEGKCD LKEKWFGTQY SIEDIENSWA ELWNSNFELN 650
PDLHLPAENK YIATDFTLKA FDCPETEYPV KIVNTPQGCL WYKKDNKFKI 700
PKAYIRFHLI SPLIQKSAAN VVLFDIFVNI LTHNLAEPAY EADVAQLEYK 750
LVAGEHGLII RVKGFNHKLP LLFQLIIDYL AEFNSTPAVF TMITEQLKKT 800
YFNILIKPET LAKDVRLLIL EYARWSMIDK YQALMDGLSL ESLLSFVKEF 850
KSQLFVEGLV QGNVTSTESM DFLKYVVDKL NFKPLEQEMP VQFQVVELPS 900
GHHLCKVKAL NKGDANSEVT VYYQSGTRSL REYTLMELLV MHMEEPCFDF 950
LRTKQTLGYH VYPTCRNTSG ILGFSVTVGT QATKYNSEVV DKKIEEFLSS 1000
FEEKIENLTE EAFNTQVTAL IKLKECEDTH LGEEVDRNWN EVVTQQYLFD 1050
RLAHEIEALK SFSKSDLVNW FKAHRGPGSK MLSVHVVGYG KYELEEDGTP 1100
SSEDSNSSCE VMQLTYLPTS PLLADCIIPI TDIRAFTTTL NLLPYHKIVK 1150
Length:1,150
Mass (Da):131,572
Last modified:April 11, 2003 - v2
Checksum:i3B46DADB898E038B
GO
Isoform 2 (identifier: O43847-2) [UniParc]FASTAAdd to Basket

Also known as: NRD2

The sequence of this isoform differs from the canonical sequence as follows:
     209-209: Q → QQLQSLFLLWSKLTDRLWFKSTYSKMSSTLLVETRNLYGVVGAESRSAPVQHLAGWQAEEQQGETDTVL

Show »
Length:1,218
Mass (Da):139,284
Checksum:i071971B4E83016AF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti153 – 1531E → EE.3 Publications
VAR_021221
Natural varianti831 – 8311Y → S.
Corresponds to variant rs34957144 [ dbSNP | Ensembl ].
VAR_057058

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei209 – 2091Q → QQLQSLFLLWSKLTDRLWFK STYSKMSSTLLVETRNLYGV VGAESRSAPVQHLAGWQAEE QQGETDTVL in isoform 2. VSP_007114

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti23 – 242EL → DV in CAA63698. 1 Publication
Sequence conflicti23 – 242EL → DV in CAA63694. 1 Publication
Sequence conflicti526 – 5261Q → L in CAA63698. 1 Publication
Sequence conflicti526 – 5261Q → L in CAA63694. 1 Publication
Sequence conflicti640 – 6401A → G in AAC39597. 1 Publication
Sequence conflicti752 – 7521V → A in CAA63698. 1 Publication
Sequence conflicti752 – 7521V → A in CAA63694. 1 Publication
Sequence conflicti1086 – 10861V → A in AAC39597. 1 Publication
Sequence conflicti1099 – 10991T → S in CAA63698. 1 Publication
Sequence conflicti1099 – 10991T → S in CAA63694. 1 Publication
Sequence conflicti1125 – 115026DCIIP…HKIVK → SVSSPLLISGLSQQHSTFSP TIK1 PublicationAdd
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U64898 mRNA. Translation: AAC39597.1.
X93209 mRNA. Translation: CAA63698.1.
X93207 mRNA. Translation: CAA63694.1.
AL589663, AL050343 Genomic DNA. Translation: CAH74100.1.
AL050343, AL589663 Genomic DNA. Translation: CAI22216.1.
CH471059 Genomic DNA. Translation: EAX06809.1.
BC008775 mRNA. Translation: AAH08775.1.
AJ000350 Genomic DNA. Translation: CAA04025.1.
RefSeqiNP_001095132.1. NM_001101662.1.
NP_001229290.1. NM_001242361.1.
NP_002516.2. NM_002525.2.
UniGeneiHs.584782.

Genome annotation databases

EnsembliENST00000352171; ENSP00000262679; ENSG00000078618.
GeneIDi4898.
KEGGihsa:4898.
UCSCiuc009vzb.3. human. [O43847-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U64898 mRNA. Translation: AAC39597.1 .
X93209 mRNA. Translation: CAA63698.1 .
X93207 mRNA. Translation: CAA63694.1 .
AL589663 , AL050343 Genomic DNA. Translation: CAH74100.1 .
AL050343 , AL589663 Genomic DNA. Translation: CAI22216.1 .
CH471059 Genomic DNA. Translation: EAX06809.1 .
BC008775 mRNA. Translation: AAH08775.1 .
AJ000350 Genomic DNA. Translation: CAA04025.1 .
RefSeqi NP_001095132.1. NM_001101662.1.
NP_001229290.1. NM_001242361.1.
NP_002516.2. NM_002525.2.
UniGenei Hs.584782.

3D structure databases

ProteinModelPortali O43847.
SMRi O43847. Positions 206-1088.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110954. 38 interactions.
IntActi O43847. 7 interactions.
STRINGi 9606.ENSP00000346890.

Protein family/group databases

MEROPSi M16.005.

PTM databases

PhosphoSitei O43847.

Proteomic databases

MaxQBi O43847.
PaxDbi O43847.
PRIDEi O43847.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000352171 ; ENSP00000262679 ; ENSG00000078618 .
GeneIDi 4898.
KEGGi hsa:4898.
UCSCi uc009vzb.3. human. [O43847-1 ]

Organism-specific databases

CTDi 4898.
GeneCardsi GC01M052254.
H-InvDB HIX0000576.
HGNCi HGNC:7995. NRD1.
HPAi HPA023679.
HPA053661.
MIMi 602651. gene.
neXtProti NX_O43847.
PharmGKBi PA31774.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1025.
HOVERGENi HBG006530.
KOi K01411.
OrthoDBi EOG7HHWRD.
PhylomeDBi O43847.

Enzyme and pathway databases

BRENDAi 3.4.24.61. 2681.
SignaLinki O43847.

Miscellaneous databases

ChiTaRSi NRD1. human.
GeneWikii NRD1.
GenomeRNAii 4898.
NextBioi 18847.
PROi O43847.
SOURCEi Search...

Gene expression databases

ArrayExpressi O43847.
Bgeei O43847.
CleanExi HS_NRD1.
Genevestigatori O43847.

Family and domain databases

Gene3Di 3.30.830.10. 5 hits.
InterProi IPR011249. Metalloenz_LuxS/M16.
IPR011237. Pept_M16_dom.
IPR011765. Pept_M16_N.
IPR001431. Pept_M16_Zn_BS.
IPR007863. Peptidase_M16_C.
[Graphical view ]
Pfami PF00675. Peptidase_M16. 1 hit.
PF05193. Peptidase_M16_C. 2 hits.
[Graphical view ]
SUPFAMi SSF63411. SSF63411. 5 hits.
PROSITEi PS00143. INSULINASE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human NRD convertase: a highly conserved metalloendopeptidase expressed at specific sites during development and in adult tissues."
    Fumagalli P., Accarino M., Egeo A., Scartezzini P., Rappazzo G., Pizzuti A., Avvantaggiato V., Simeone A., Arrigo G., Zuffardi O., Ottolenghi S., Taramelli R.
    Genomics 47:238-245(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Heart.
  2. "Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family."
    Hospital V., Prat A., Joulie C., Cherif D., Day R., Cohen P.
    Biochem. J. 327:773-779(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT GLU-153 INS.
    Tissue: Testis.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-153 INS.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-153 INS.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  6. "Gene expression of the dibasic-pair cleaving enzyme NRD convertase (N-arginine dibasic convertase) is differentially regulated in the GH3 pituitary and Mat-Lu prostate cell lines."
    Winter A.G., Pierotti A.R.
    Biochem. J. 351:755-764(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-107.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiNRDC_HUMAN
AccessioniPrimary (citable) accession number: O43847
Secondary accession number(s): A6NI41
, O15241, O15242, Q5VUL0, Q96HB2, Q9NU57
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: April 11, 2003
Last modified: June 11, 2014
This is version 127 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi