O43847 (NRDC_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nardilysin EC=3.4.24.61 Alternative name(s): N-arginine dibasic convertase Short name=NRD convertase Short name=NRD-C | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1150 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs. |
| Catalytic activity | Hydrolysis of polypeptides, preferably at -Xaa-|-Arg-Lys-, and less commonly at -Arg-|-Arg-Xaa-, in which Xaa is not Arg or Lys. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Tissue specificity | Primarily in adult heart, skeletal muscle, and testis and at much lower levels in other tissues. |
| Sequence similarities | Belongs to the peptidase M16 family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43847-1) Also known as: NRD1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43847-2) Also known as: NRD2; The sequence of this isoform differs from the canonical sequence as follows: 209-209: Q → QQLQSLFLLWSKLTDRLWFKSTYSKMSSTLLVETRNLYGVVGAESRSAPVQHLAGWQAEEQQGETDTVL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | Potential | ||||||
| Chain | 21 – 1150 | 1130 | Nardilysin | PRO_0000026755 | |||||
Regions | |||||||||
| Compositional bias | 142 – 200 | 59 | Asp/Glu-rich (highly acidic) | ||||||
| Compositional bias | 144 – 153 | 10 | Poly-Glu | ||||||
Sites | |||||||||
| Active site | 235 | 1 | Proton acceptor By similarity | ||||||
| Metal binding | 232 | 1 | Zinc By similarity | ||||||
| Metal binding | 236 | 1 | Zinc By similarity | ||||||
| Metal binding | 313 | 1 | Zinc By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 86 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 94 | 1 | Phosphoserine Ref.7 Ref.8 Ref.9 Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 209 | 1 | Q → QQLQSLFLLWSKLTDRLWFK STYSKMSSTLLVETRNLYGV VGAESRSAPVQHLAGWQAEE QQGETDTVL in isoform 2. | VSP_007114 | |||||
| Natural variant | 153 | 1 | E → EE. Ref.2 Ref.3 Ref.4 | VAR_021221 | |||||
| Natural variant | 831 | 1 | Y → S. Corresponds to variant rs34957144 [ dbSNP | Ensembl ]. | VAR_057058 | |||||
Experimental info | |||||||||
| Sequence conflict | 23 – 24 | 2 | EL → DV in CAA63698. Ref.2 | ||||||
| Sequence conflict | 23 – 24 | 2 | EL → DV in CAA63694. Ref.2 | ||||||
| Sequence conflict | 526 | 1 | Q → L in CAA63698. Ref.2 | ||||||
| Sequence conflict | 526 | 1 | Q → L in CAA63694. Ref.2 | ||||||
| Sequence conflict | 640 | 1 | A → G in AAC39597. Ref.1 | ||||||
| Sequence conflict | 752 | 1 | V → A in CAA63698. Ref.2 | ||||||
| Sequence conflict | 752 | 1 | V → A in CAA63694. Ref.2 | ||||||
| Sequence conflict | 1086 | 1 | V → A in AAC39597. Ref.1 | ||||||
| Sequence conflict | 1099 | 1 | T → S in CAA63698. Ref.2 | ||||||
| Sequence conflict | 1099 | 1 | T → S in CAA63694. Ref.2 | ||||||
| Sequence conflict | 1125 – 1150 | 26 | DCIIP…HKIVK → SVSSPLLISGLSQQHSTFSP TIK Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human NRD convertase: a highly conserved metalloendopeptidase expressed at specific sites during development and in adult tissues." Fumagalli P., Accarino M., Egeo A., Scartezzini P., Rappazzo G., Pizzuti A., Avvantaggiato V., Simeone A., Arrigo G., Zuffardi O., Ottolenghi S., Taramelli R. Genomics 47:238-245(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Heart. |
| [2] | "Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family." Hospital V., Prat A., Joulie C., Cherif D., Day R., Cohen P. Biochem. J. 327:773-779(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT GLU-153 INS. Tissue: Testis. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-153 INS. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-153 INS. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [6] | "Gene expression of the dibasic-pair cleaving enzyme NRD convertase (N-arginine dibasic convertase) is differentially regulated in the GH3 pituitary and Mat-Lu prostate cell lines." Winter A.G., Pierotti A.R. Biochem. J. 351:755-764(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-107. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [9] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U64898 mRNA. Translation: AAC39597.1. X93209 mRNA. Translation: CAA63698.1. X93207 mRNA. Translation: CAA63694.1. AL589663, AL050343 Genomic DNA. Translation: CAH74100.1. AL050343, AL589663 Genomic DNA. Translation: CAI22216.1. CH471059 Genomic DNA. Translation: EAX06809.1. BC008775 mRNA. Translation: AAH08775.1. AJ000350 Genomic DNA. Translation: CAA04025.1. |
| IPI | IPI00478723. IPI00889668. |
| RefSeq | NP_001095132.1. NM_001101662.1. NP_001229290.1. NM_001242361.1. NP_002516.2. NM_002525.2. |
| UniGene | Hs.584782. |
3D structure databases | |
| ProteinModelPortal | O43847. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O43847. 6 interactions. |
| STRING | 9606.ENSP00000346890. |
Protein family/group databases | |
| MEROPS | M16.983. |
PTM databases | |
| PhosphoSite | O43847. |
Proteomic databases | |
| PaxDb | O43847. |
| PRIDE | O43847. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000352171; ENSP00000262679; ENSG00000078618. |
| GeneID | 4898. |
| KEGG | hsa:4898. |
| UCSC | uc009vzb.3. human. |
Organism-specific databases | |
| CTD | 4898. |
| GeneCards | GC01M052254. |
| H-InvDB | HIX0000576. |
| HGNC | HGNC:7995. NRD1. |
| HPA | HPA023679. |
| MIM | 602651. gene. |
| neXtProt | NX_O43847. |
| PharmGKB | PA31774. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1025. |
| HOVERGEN | HBG006530. |
| KO | K01411. |
| OrthoDB | EOG4PC9R9. |
Enzyme and pathway databases | |
| BRENDA | 3.4.24.61. 2681. |
Gene expression databases | |
| ArrayExpress | O43847. |
| Bgee | O43847. |
| CleanEx | HS_NRD1. |
| Genevestigator | O43847. |
| GermOnline | ENSG00000078618. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.830.10. 5 hits. |
| InterPro | IPR011249. Metalloenz_LuxS/M16. IPR011237. Pept_M16_dom. IPR011765. Pept_M16_N. IPR001431. Pept_M16_Zn_BS. IPR007863. Peptidase_M16_C. [Graphical view] |
| Pfam | PF00675. Peptidase_M16. 1 hit. PF05193. Peptidase_M16_C. 2 hits. [Graphical view] |
| SUPFAM | SSF63411. Metalloenz_metal-bd. 4 hits. |
| PROSITE | PS00143. INSULINASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | NRD1. human. |
| GenomeRNAi | 4898. |
| NextBio | 18847. |
| SOURCE | Search... |
Entry information
| Entry name | NRDC_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43847 Secondary accession number(s): A6NI41 Q9NU57 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
