Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O43815

- STRN_HUMAN

UniProt

O43815 - STRN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Striatin

Gene

STRN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Calmodulin-binding protein which may function as scaffolding or signaling protein and may play a role in dendritic Ca2+ signaling.

GO - Molecular functioni

  1. armadillo repeat domain binding Source: UniProtKB
  2. calmodulin binding Source: UniProtKB
  3. estrogen receptor binding Source: UniProtKB
  4. protein complex binding Source: UniProtKB
  5. protein phosphatase 2A binding Source: UniProtKB

GO - Biological processi

  1. dendrite development Source: UniProtKB
  2. locomotory behavior Source: UniProtKB
  3. negative regulation of cell proliferation Source: UniProtKB
  4. tight junction assembly Source: UniProtKB
  5. Wnt signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Calmodulin-binding

Enzyme and pathway databases

SignaLinkiO43815.

Names & Taxonomyi

Protein namesi
Recommended name:
Striatin
Gene namesi
Name:STRN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:11424. STRN.

Subcellular locationi

Cytoplasm By similarity. Membrane By similarity; Peripheral membrane protein By similarity. Cell projectiondendritic spine By similarity
Note: CTTNBP2-binding may regulate dendritic spine distribution.By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. dendritic spine Source: UniProtKB
  3. membrane Source: UniProtKB
  4. neuronal cell body Source: UniProtKB
  5. postsynaptic density Source: UniProtKB
  6. postsynaptic membrane Source: UniProtKB
  7. tight junction Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36224.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 780780StriatinPRO_0000051232Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei245 – 2451Phosphoserine3 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO43815.
PaxDbiO43815.
PRIDEiO43815.

PTM databases

PhosphoSiteiO43815.

Miscellaneous databases

PMAP-CutDBO43815.

Expressioni

Tissue specificityi

Preferentially expressed in brain.1 Publication

Gene expression databases

BgeeiO43815.
CleanExiHS_STRN.
GenevestigatoriO43815.

Organism-specific databases

HPAiHPA017286.

Interactioni

Subunit structurei

Interacts with protein phosphatase 2A (PP2A) (Potential). Interacts with CTTNBP2; this interaction may regulate dendritic spine distribution of STRN. Activation of glutamate receptors weakens the interaction with CTTNBP2 (By similarity).By similarityCurated

Binary interactionsi

WithEntry#Exp.IntActNotes
CTTNBP2NLQ9P2B45EBI-1046642,EBI-1774273
MOB4Q9Y3A34EBI-1046642,EBI-713935
PDCD10Q9BUL83EBI-1046642,EBI-740195
PPP2CAP677753EBI-1046642,EBI-712311
PPP2R1AP301534EBI-1046642,EBI-302388
STK24Q9Y6E03EBI-1046642,EBI-740175
STK25O005063EBI-1046642,EBI-618295
STRN3Q130337EBI-1046642,EBI-1053857
TNKS2Q9H2K22EBI-1046642,EBI-4398527
TRAF3IP3Q9Y2282EBI-1046642,EBI-765817

Protein-protein interaction databases

BioGridi112674. 50 interactions.
IntActiO43815. 37 interactions.
MINTiMINT-2796380.
STRINGi9606.ENSP00000263918.

Structurei

3D structure databases

ProteinModelPortaliO43815.
SMRiO43815. Positions 70-114, 401-779.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati461 – 50040WD 1Add
BLAST
Repeati514 – 55340WD 2Add
BLAST
Repeati567 – 60640WD 3Add
BLAST
Repeati662 – 70140WD 4Add
BLAST
Repeati704 – 74340WD 5Add
BLAST
Repeati750 – 77930WD 6Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni55 – 639Caveolin-bindingSequence Analysis
Regioni149 – 16618Calmodulin-bindingSequence AnalysisAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili53 – 12068Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the WD repeat striatin family.Curated
Contains 6 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
GeneTreeiENSGT00520000055597.
HOGENOMiHOG000236343.
HOVERGENiHBG007117.
InParanoidiO43815.
KOiK17608.
OMAiGPISEAW.
OrthoDBiEOG79KPDR.
PhylomeDBiO43815.
TreeFamiTF313387.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR013258. Striatin_N.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF08232. Striatin. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 4 hits.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O43815-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEQAGPGVF FSNNHPGAGG AKGLGPLAEA AAAGDGAAAA GAARAQYSLP
60 70 80 90 100
GILHFLQHEW ARFEVERAQW EVERAELQAQ IAFLQGERKG QENLKKDLVR
110 120 130 140 150
RIKMLEYALK QERAKYHKLK YGTELNQGDM KPPSYDSDEG NETEVQPQQN
160 170 180 190 200
SQLMWKQGRQ LLRQYLQEVG YTDTILDVKS KRVRALLGFS SDVTDREDDK
210 220 230 240 250
NQDSVVNGTE AEVKETAMIA KSELTDSASV LDNFKFLESA AADFSDEDED
260 270 280 290 300
DDVDGREKSV IDTSTIVRKK ALPDSGEDRD TKEALKEFDF LVTSEEGDNE
310 320 330 340 350
SRSAGDGTDW EKEDQCLMPE AWNVDQGVIT KLKEQYKKER KGKKGVKRPN
360 370 380 390 400
RSKLQDMLAN LRDVDELPSL QPSVGSPSRP SSSRLPEHEI NRADEVEALT
410 420 430 440 450
FPPSSGKSFI MGADEALESE LGLGELAGLT VANEADSLTY DIANNKDALR
460 470 480 490 500
KTWNPKFTLR SHFDGIRALA FHPIEPVLIT ASEDHTLKMW NLQKTAPAKK
510 520 530 540 550
STSLDVEPIY TFRAHKGPVL CVVMSSNGEQ CYSGGTDGLI QGWNTTNPNI
560 570 580 590 600
DPYDSYDPSV LRGPLLGHTD AVWGLAYSAA HQRLLSCSAD GTLRLWNTTE
610 620 630 640 650
VAPALSVFND TKELGIPASV DLVSSDPSHM VASFSKGYTS IFNMETQQRI
660 670 680 690 700
LTLESNVDTT ANSSCQINRV ISHPTLPISI TAHEDRHIKF YDNNTGKLIH
710 720 730 740 750
SMVAHLEAVT SLAVDPNGLY LMSGSHDCSI RLWNLESKTC IQEFTAHRKK
760 770 780
FEESIHDVAF HPSKCYIASA GADALAKVFV
Length:780
Mass (Da):86,132
Last modified:March 6, 2007 - v4
Checksum:iDDB18A11102BEA35
GO
Isoform 2 (identifier: O43815-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-40: Missing.
     311-348: EKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKR → G

Note: No experimental confirmation available.

Show »
Length:731
Mass (Da):80,761
Checksum:i67B5DD94E3499AB7
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti191 – 1911S → I in CAA11560. (PubMed:9693043)Curated
Sequence conflicti423 – 4231L → P in CAA11560. (PubMed:9693043)Curated
Sequence conflicti611 – 6111T → I in CAA11560. (PubMed:9693043)Curated
Sequence conflicti677 – 6771P → S in CAA11560. (PubMed:9693043)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei29 – 4012Missing in isoform 2. 1 PublicationVSP_023495Add
BLAST
Alternative sequencei311 – 34838EKEDQ…KGVKR → G in isoform 2. 1 PublicationVSP_023496Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ223814 mRNA. Translation: CAA11560.1.
AC007404 Genomic DNA. Translation: AAY24273.1.
AC007382 Genomic DNA. Translation: AAF66162.1.
BC106879 mRNA. Translation: AAI06880.1.
CCDSiCCDS1784.1. [O43815-1]
RefSeqiNP_003153.2. NM_003162.3. [O43815-1]
UniGeneiHs.127486.

Genome annotation databases

EnsembliENST00000263918; ENSP00000263918; ENSG00000115808. [O43815-1]
ENST00000379213; ENSP00000368513; ENSG00000115808. [O43815-2]
GeneIDi6801.
KEGGihsa:6801.
UCSCiuc002rpn.3. human. [O43815-1]
uc010ezx.3. human. [O43815-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ223814 mRNA. Translation: CAA11560.1 .
AC007404 Genomic DNA. Translation: AAY24273.1 .
AC007382 Genomic DNA. Translation: AAF66162.1 .
BC106879 mRNA. Translation: AAI06880.1 .
CCDSi CCDS1784.1. [O43815-1 ]
RefSeqi NP_003153.2. NM_003162.3. [O43815-1 ]
UniGenei Hs.127486.

3D structure databases

ProteinModelPortali O43815.
SMRi O43815. Positions 70-114, 401-779.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112674. 50 interactions.
IntActi O43815. 37 interactions.
MINTi MINT-2796380.
STRINGi 9606.ENSP00000263918.

PTM databases

PhosphoSitei O43815.

Proteomic databases

MaxQBi O43815.
PaxDbi O43815.
PRIDEi O43815.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000263918 ; ENSP00000263918 ; ENSG00000115808 . [O43815-1 ]
ENST00000379213 ; ENSP00000368513 ; ENSG00000115808 . [O43815-2 ]
GeneIDi 6801.
KEGGi hsa:6801.
UCSCi uc002rpn.3. human. [O43815-1 ]
uc010ezx.3. human. [O43815-2 ]

Organism-specific databases

CTDi 6801.
GeneCardsi GC02M036987.
HGNCi HGNC:11424. STRN.
HPAi HPA017286.
MIMi 614765. gene.
neXtProti NX_O43815.
PharmGKBi PA36224.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2319.
GeneTreei ENSGT00520000055597.
HOGENOMi HOG000236343.
HOVERGENi HBG007117.
InParanoidi O43815.
KOi K17608.
OMAi GPISEAW.
OrthoDBi EOG79KPDR.
PhylomeDBi O43815.
TreeFami TF313387.

Enzyme and pathway databases

SignaLinki O43815.

Miscellaneous databases

GeneWikii STRN.
GenomeRNAii 6801.
NextBioi 26559.
PMAP-CutDB O43815.
PROi O43815.
SOURCEi Search...

Gene expression databases

Bgeei O43815.
CleanExi HS_STRN.
Genevestigatori O43815.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
InterProi IPR020472. G-protein_beta_WD-40_rep.
IPR013258. Striatin_N.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF08232. Striatin. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view ]
PRINTSi PR00320. GPROTEINBRPT.
SMARTi SM00320. WD40. 6 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 1 hit.
PROSITEi PS00678. WD_REPEATS_1. 4 hits.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of human striatin cDNA (STRN), gene mapping to 2p22-p21, and preferential expression in brain."
    Moqrich A., Mattei M.-G., Bartoli M., Rakitina T., Baillat G., Monneron A., Castets F.
    Genomics 51:136-139(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  5. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSTRN_HUMAN
AccessioniPrimary (citable) accession number: O43815
Secondary accession number(s): Q3KP65, Q53TQ8, Q9NP38
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: March 6, 2007
Last modified: October 29, 2014
This is version 137 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3