Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O43815

- STRN_HUMAN

UniProt

O43815 - STRN_HUMAN

Protein

Striatin

Gene

STRN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 136 (01 Oct 2014)
      Sequence version 4 (06 Mar 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Calmodulin-binding protein which may function as scaffolding or signaling protein and may play a role in dendritic Ca2+ signaling.

    GO - Molecular functioni

    1. armadillo repeat domain binding Source: UniProtKB
    2. calmodulin binding Source: UniProtKB
    3. estrogen receptor binding Source: UniProtKB
    4. protein binding Source: IntAct
    5. protein complex binding Source: UniProtKB
    6. protein phosphatase 2A binding Source: UniProtKB

    GO - Biological processi

    1. dendrite development Source: UniProtKB
    2. locomotory behavior Source: UniProtKB
    3. negative regulation of cell proliferation Source: UniProtKB
    4. tight junction assembly Source: UniProtKB
    5. Wnt signaling pathway Source: UniProtKB

    Keywords - Ligandi

    Calmodulin-binding

    Enzyme and pathway databases

    SignaLinkiO43815.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Striatin
    Gene namesi
    Name:STRN
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:11424. STRN.

    Subcellular locationi

    Cytoplasm By similarity. Membrane By similarity; Peripheral membrane protein By similarity. Cell projectiondendritic spine By similarity
    Note: CTTNBP2-binding may regulate dendritic spine distribution.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. dendritic spine Source: UniProtKB
    3. membrane Source: UniProtKB
    4. neuronal cell body Source: UniProtKB
    5. postsynaptic density Source: UniProtKB
    6. postsynaptic membrane Source: UniProtKB
    7. tight junction Source: UniProtKB

    Keywords - Cellular componenti

    Cell projection, Cytoplasm, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36224.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 780780StriatinPRO_0000051232Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei245 – 2451Phosphoserine3 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO43815.
    PaxDbiO43815.
    PRIDEiO43815.

    PTM databases

    PhosphoSiteiO43815.

    Miscellaneous databases

    PMAP-CutDBO43815.

    Expressioni

    Tissue specificityi

    Preferentially expressed in brain.1 Publication

    Gene expression databases

    BgeeiO43815.
    CleanExiHS_STRN.
    GenevestigatoriO43815.

    Organism-specific databases

    HPAiHPA017286.

    Interactioni

    Subunit structurei

    Interacts with protein phosphatase 2A (PP2A) Potential. Interacts with CTTNBP2; this interaction may regulate dendritic spine distribution of STRN. Activation of glutamate receptors weakens the interaction with CTTNBP2 By similarity.By similarityCurated

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CTTNBP2NLQ9P2B45EBI-1046642,EBI-1774273
    MOB4Q9Y3A34EBI-1046642,EBI-713935
    PDCD10Q9BUL83EBI-1046642,EBI-740195
    PPP2CAP677753EBI-1046642,EBI-712311
    PPP2R1AP301534EBI-1046642,EBI-302388
    STK24Q9Y6E03EBI-1046642,EBI-740175
    STK25O005063EBI-1046642,EBI-618295
    STRN3Q130337EBI-1046642,EBI-1053857
    TNKS2Q9H2K22EBI-1046642,EBI-4398527
    TRAF3IP3Q9Y2282EBI-1046642,EBI-765817

    Protein-protein interaction databases

    BioGridi112674. 46 interactions.
    IntActiO43815. 37 interactions.
    MINTiMINT-2796380.
    STRINGi9606.ENSP00000263918.

    Structurei

    3D structure databases

    ProteinModelPortaliO43815.
    SMRiO43815. Positions 70-114, 401-779.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati461 – 50040WD 1Add
    BLAST
    Repeati514 – 55340WD 2Add
    BLAST
    Repeati567 – 60640WD 3Add
    BLAST
    Repeati662 – 70140WD 4Add
    BLAST
    Repeati704 – 74340WD 5Add
    BLAST
    Repeati750 – 77930WD 6Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni55 – 639Caveolin-bindingSequence Analysis
    Regioni149 – 16618Calmodulin-bindingSequence AnalysisAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili53 – 12068Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the WD repeat striatin family.Curated
    Contains 6 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Repeat, WD repeat

    Phylogenomic databases

    eggNOGiCOG2319.
    HOGENOMiHOG000236343.
    HOVERGENiHBG007117.
    InParanoidiO43815.
    KOiK17608.
    OMAiGPISEAW.
    OrthoDBiEOG79KPDR.
    PhylomeDBiO43815.
    TreeFamiTF313387.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    InterProiIPR020472. G-protein_beta_WD-40_rep.
    IPR013258. Striatin_N.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF08232. Striatin. 1 hit.
    PF00400. WD40. 5 hits.
    [Graphical view]
    PRINTSiPR00320. GPROTEINBRPT.
    SMARTiSM00320. WD40. 6 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 1 hit.
    PROSITEiPS00678. WD_REPEATS_1. 4 hits.
    PS50082. WD_REPEATS_2. 4 hits.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O43815-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDEQAGPGVF FSNNHPGAGG AKGLGPLAEA AAAGDGAAAA GAARAQYSLP    50
    GILHFLQHEW ARFEVERAQW EVERAELQAQ IAFLQGERKG QENLKKDLVR 100
    RIKMLEYALK QERAKYHKLK YGTELNQGDM KPPSYDSDEG NETEVQPQQN 150
    SQLMWKQGRQ LLRQYLQEVG YTDTILDVKS KRVRALLGFS SDVTDREDDK 200
    NQDSVVNGTE AEVKETAMIA KSELTDSASV LDNFKFLESA AADFSDEDED 250
    DDVDGREKSV IDTSTIVRKK ALPDSGEDRD TKEALKEFDF LVTSEEGDNE 300
    SRSAGDGTDW EKEDQCLMPE AWNVDQGVIT KLKEQYKKER KGKKGVKRPN 350
    RSKLQDMLAN LRDVDELPSL QPSVGSPSRP SSSRLPEHEI NRADEVEALT 400
    FPPSSGKSFI MGADEALESE LGLGELAGLT VANEADSLTY DIANNKDALR 450
    KTWNPKFTLR SHFDGIRALA FHPIEPVLIT ASEDHTLKMW NLQKTAPAKK 500
    STSLDVEPIY TFRAHKGPVL CVVMSSNGEQ CYSGGTDGLI QGWNTTNPNI 550
    DPYDSYDPSV LRGPLLGHTD AVWGLAYSAA HQRLLSCSAD GTLRLWNTTE 600
    VAPALSVFND TKELGIPASV DLVSSDPSHM VASFSKGYTS IFNMETQQRI 650
    LTLESNVDTT ANSSCQINRV ISHPTLPISI TAHEDRHIKF YDNNTGKLIH 700
    SMVAHLEAVT SLAVDPNGLY LMSGSHDCSI RLWNLESKTC IQEFTAHRKK 750
    FEESIHDVAF HPSKCYIASA GADALAKVFV 780
    Length:780
    Mass (Da):86,132
    Last modified:March 6, 2007 - v4
    Checksum:iDDB18A11102BEA35
    GO
    Isoform 2 (identifier: O43815-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         29-40: Missing.
         311-348: EKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKR → G

    Note: No experimental confirmation available.

    Show »
    Length:731
    Mass (Da):80,761
    Checksum:i67B5DD94E3499AB7
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti191 – 1911S → I in CAA11560. (PubMed:9693043)Curated
    Sequence conflicti423 – 4231L → P in CAA11560. (PubMed:9693043)Curated
    Sequence conflicti611 – 6111T → I in CAA11560. (PubMed:9693043)Curated
    Sequence conflicti677 – 6771P → S in CAA11560. (PubMed:9693043)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei29 – 4012Missing in isoform 2. 1 PublicationVSP_023495Add
    BLAST
    Alternative sequencei311 – 34838EKEDQ…KGVKR → G in isoform 2. 1 PublicationVSP_023496Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ223814 mRNA. Translation: CAA11560.1.
    AC007404 Genomic DNA. Translation: AAY24273.1.
    AC007382 Genomic DNA. Translation: AAF66162.1.
    BC106879 mRNA. Translation: AAI06880.1.
    CCDSiCCDS1784.1. [O43815-1]
    RefSeqiNP_003153.2. NM_003162.3. [O43815-1]
    UniGeneiHs.127486.

    Genome annotation databases

    EnsembliENST00000263918; ENSP00000263918; ENSG00000115808. [O43815-1]
    ENST00000379213; ENSP00000368513; ENSG00000115808. [O43815-2]
    GeneIDi6801.
    KEGGihsa:6801.
    UCSCiuc002rpn.3. human. [O43815-1]
    uc010ezx.3. human. [O43815-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ223814 mRNA. Translation: CAA11560.1 .
    AC007404 Genomic DNA. Translation: AAY24273.1 .
    AC007382 Genomic DNA. Translation: AAF66162.1 .
    BC106879 mRNA. Translation: AAI06880.1 .
    CCDSi CCDS1784.1. [O43815-1 ]
    RefSeqi NP_003153.2. NM_003162.3. [O43815-1 ]
    UniGenei Hs.127486.

    3D structure databases

    ProteinModelPortali O43815.
    SMRi O43815. Positions 70-114, 401-779.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112674. 46 interactions.
    IntActi O43815. 37 interactions.
    MINTi MINT-2796380.
    STRINGi 9606.ENSP00000263918.

    PTM databases

    PhosphoSitei O43815.

    Proteomic databases

    MaxQBi O43815.
    PaxDbi O43815.
    PRIDEi O43815.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000263918 ; ENSP00000263918 ; ENSG00000115808 . [O43815-1 ]
    ENST00000379213 ; ENSP00000368513 ; ENSG00000115808 . [O43815-2 ]
    GeneIDi 6801.
    KEGGi hsa:6801.
    UCSCi uc002rpn.3. human. [O43815-1 ]
    uc010ezx.3. human. [O43815-2 ]

    Organism-specific databases

    CTDi 6801.
    GeneCardsi GC02M036987.
    HGNCi HGNC:11424. STRN.
    HPAi HPA017286.
    MIMi 614765. gene.
    neXtProti NX_O43815.
    PharmGKBi PA36224.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2319.
    HOGENOMi HOG000236343.
    HOVERGENi HBG007117.
    InParanoidi O43815.
    KOi K17608.
    OMAi GPISEAW.
    OrthoDBi EOG79KPDR.
    PhylomeDBi O43815.
    TreeFami TF313387.

    Enzyme and pathway databases

    SignaLinki O43815.

    Miscellaneous databases

    GeneWikii STRN.
    GenomeRNAii 6801.
    NextBioi 26559.
    PMAP-CutDB O43815.
    PROi O43815.
    SOURCEi Search...

    Gene expression databases

    Bgeei O43815.
    CleanExi HS_STRN.
    Genevestigatori O43815.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    InterProi IPR020472. G-protein_beta_WD-40_rep.
    IPR013258. Striatin_N.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF08232. Striatin. 1 hit.
    PF00400. WD40. 5 hits.
    [Graphical view ]
    PRINTSi PR00320. GPROTEINBRPT.
    SMARTi SM00320. WD40. 6 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 1 hit.
    PROSITEi PS00678. WD_REPEATS_1. 4 hits.
    PS50082. WD_REPEATS_2. 4 hits.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of human striatin cDNA (STRN), gene mapping to 2p22-p21, and preferential expression in brain."
      Moqrich A., Mattei M.-G., Bartoli M., Rakitina T., Baillat G., Monneron A., Castets F.
      Genomics 51:136-139(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    5. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSTRN_HUMAN
    AccessioniPrimary (citable) accession number: O43815
    Secondary accession number(s): Q3KP65, Q53TQ8, Q9NP38
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: March 6, 2007
    Last modified: October 1, 2014
    This is version 136 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3