Reviewed,
UniProtKB/Swiss-Prot O43815 (STRN_HUMAN)
Last modified
June 16, 2009.
Version 81.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Striatin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 780 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Calmodulin-binding protein which may function as scaffolding or signaling protein and may play a role in dendritic Ca2+ signaling. |
| Subunit structure | Interacts with protein phosphatase 2A (PP2A) Potential. |
| Subcellular location | Cytoplasm By similarity. Membrane; Peripheral membrane protein By similarity. |
| Tissue specificity | Preferentially expressed in brain. Ref.1 |
| Sequence similarities | Belongs to the WD repeat striatin family. Contains 6 WD repeats. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Repeat WD repeat |
| Ligand | Calmodulin-binding |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | calmodulin binding Ref.1 Non-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| MCC | P23508 | 1 | EBI-1046642,EBI-307531 | |
| STK24 | Q5T5B3 | 1 | EBI-1046642,EBI-1054809 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43815-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43815-2) The sequence of this isoform differs from the canonical sequence as follows: 29-40: Missing. 311-348: EKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKR → G | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 780 | 780 | Striatin | PRO_0000051232 | |||||
Regions | |||||||||
| Repeat | 461 – 500 | 40 | WD 1 | ||||||
| Repeat | 514 – 553 | 40 | WD 2 | ||||||
| Repeat | 567 – 606 | 40 | WD 3 | ||||||
| Repeat | 662 – 701 | 40 | WD 4 | ||||||
| Repeat | 704 – 743 | 40 | WD 5 | ||||||
| Repeat | 750 – 779 | 30 | WD 6 | ||||||
| Region | 55 – 63 | 9 | Caveolin-binding Potential | ||||||
| Region | 149 – 166 | 18 | Calmodulin-binding Potential | ||||||
| Coiled coil | 53 – 120 | 68 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 245 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 264 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 29 – 40 | 12 | Missing in isoform 2. | VSP_023495 | |||||
| Alternative sequence | 311 – 348 | 38 | EKEDQ…KGVKR → G in isoform 2. | VSP_023496 | |||||
Experimental info | |||||||||
| Sequence conflict | 191 | 1 | S → I in CAA11560. Ref.1 | ||||||
| Sequence conflict | 423 | 1 | L → P in CAA11560. Ref.1 | ||||||
| Sequence conflict | 611 | 1 | T → I in CAA11560. Ref.1 | ||||||
| Sequence conflict | 677 | 1 | P → S in CAA11560. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of human striatin cDNA (STRN), gene mapping to 2p22-p21, and preferential expression in brain." Moqrich A., Mattei M.-G., Bartoli M., Rakitina T., Baillat G., Monneron A., Castets F. Genomics 51:136-139(1998) [PubMed: 9693043] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [4] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, MASS SPECTROMETRY. |
| [5] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AJ223814 mRNA. Translation: CAA11560.1. AC007404 Genomic DNA. Translation: AAY24273.1. AC007382 Genomic DNA. Translation: AAF66162.1. BC106879 mRNA. Translation: AAI06880.1. | |
| IPI | IPI00014456. IPI00654594. |
| RefSeq | NP_003153.2. |
| UniGene | Hs.656726 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1ERJ based on UniProtKB P16649. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O43815. 8 interactions. |
PTM databases | |
| PhosphoSite | O43815. |
Proteomic databases | |
| PRIDE | O43815. |
Genome annotation databases | |
| Ensembl | ENSG00000115808. Homo sapiens. [Contig view] |
| GeneID | 6801. |
| KEGG | hsa:6801. |
Organism-specific databases | |
| GeneCards | GC02M036924. |
| H-InvDB | HIX0001969. |
| HGNC | HGNC:11424. STRN. |
| HPA | HPA017286. |
| PharmGKB | PA36224. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | O43815. |
| HOVERGEN | O43815. |
| OMA | O43815. AYDIANN. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | er_nongenomic_pathway. Plasma membrane estrogen receptor signaling. |
Gene expression databases | |
| ArrayExpress | O43815. |
| Bgee | O43815. |
| CleanEx | HS_STRN. |
| GermOnline | ENSG00000115808. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013258. Striatin_N. IPR015943. WD40/YVTN_repeat-like. IPR001680. WD40_repeat. IPR019782. WD40_repeat_2. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_region. IPR019781. WD40_repeat_sg. [Graphical view] |
| Gene3D | G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 1 hit. |
| Pfam | PF08232. Striatin. 1 hit. PF00400. WD40. 5 hits. [Graphical view] |
| ProDom | PD000018. WD40. 2 hits. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00320. WD40. 6 hits. [Graphical view] |
| PROSITE | PS00678. WD_REPEATS_1. 4 hits. PS50082. WD_REPEATS_2. 4 hits. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 26559. |
| PMAP-CutDB | O43815. |
Entry information
| Entry name | STRN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43815 Secondary accession number(s): Q3KP65, Q53TQ8, Q9NP38 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with


