O43815 (STRN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Striatin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 780 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Calmodulin-binding protein which may function as scaffolding or signaling protein and may play a role in dendritic Ca2+ signaling. |
| Subunit structure | Interacts with protein phosphatase 2A (PP2A) Potential. |
| Subcellular location | Cytoplasm By similarity. Membrane; Peripheral membrane protein By similarity. |
| Tissue specificity | Preferentially expressed in brain. Ref.1 |
| Sequence similarities | Belongs to the WD repeat striatin family. Contains 6 WD repeats. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CTTNBP2NL | Q9P2B4 | 3 | EBI-1046642,EBI-1774273 | |
| PDCD10 | Q9BUL8 | 2 | EBI-1046642,EBI-740195 | |
| PHOCN | Q9Y3A3 | 3 | EBI-1046642,EBI-713935 | |
| PPP2CA | P67775 | 3 | EBI-1046642,EBI-712311 | |
| PPP2R1A | P30153 | 4 | EBI-1046642,EBI-302388 | |
| STK24 | Q9Y6E0 | 2 | EBI-1046642,EBI-740175 | |
| STK25 | O00506 | 2 | EBI-1046642,EBI-618295 | |
| STRN3 | Q13033 | 4 | EBI-1046642,EBI-1053857 | |
| TRAF3IP3 | Q9Y228 | 2 | EBI-1046642,EBI-765817 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43815-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43815-2) The sequence of this isoform differs from the canonical sequence as follows: 29-40: Missing. 311-348: EKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKR → G | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 780 | 780 | Striatin | PRO_0000051232 | |||||
Regions | |||||||||
| Repeat | 461 – 500 | 40 | WD 1 | ||||||
| Repeat | 514 – 553 | 40 | WD 2 | ||||||
| Repeat | 567 – 606 | 40 | WD 3 | ||||||
| Repeat | 662 – 701 | 40 | WD 4 | ||||||
| Repeat | 704 – 743 | 40 | WD 5 | ||||||
| Repeat | 750 – 779 | 30 | WD 6 | ||||||
| Region | 55 – 63 | 9 | Caveolin-binding Potential | ||||||
| Region | 149 – 166 | 18 | Calmodulin-binding Potential | ||||||
| Coiled coil | 53 – 120 | 68 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 245 | 1 | Phosphoserine Ref.4 Ref.5 Ref.6 Ref.7 | ||||||
| Modified residue | 264 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 689 | 1 | N6-acetyllysine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 29 – 40 | 12 | Missing in isoform 2. | VSP_023495 | |||||
| Alternative sequence | 311 – 348 | 38 | EKEDQ…KGVKR → G in isoform 2. | VSP_023496 | |||||
Experimental info | |||||||||
| Sequence conflict | 191 | 1 | S → I in CAA11560. Ref.1 | ||||||
| Sequence conflict | 423 | 1 | L → P in CAA11560. Ref.1 | ||||||
| Sequence conflict | 611 | 1 | T → I in CAA11560. Ref.1 | ||||||
| Sequence conflict | 677 | 1 | P → S in CAA11560. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of human striatin cDNA (STRN), gene mapping to 2p22-p21, and preferential expression in brain." Moqrich A., Mattei M.-G., Bartoli M., Rakitina T., Baillat G., Monneron A., Castets F. Genomics 51:136-139(1998) [PubMed: 9693043] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [4] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [5] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [6] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, MASS SPECTROMETRY. |
| [7] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [8] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-689, MASS SPECTROMETRY. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ223814 mRNA. Translation: CAA11560.1. AC007404 Genomic DNA. Translation: AAY24273.1. AC007382 Genomic DNA. Translation: AAF66162.1. BC106879 mRNA. Translation: AAI06880.1. |
| IPI | IPI00014456. IPI00654594. |
| RefSeq | NP_003153.2. NM_003162.3. |
| UniGene | Hs.656726. |
3D structure databases | |
| ProteinModelPortal | O43815. |
| SMR | O43815. Positions 449-779. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O43815. 25 interactions. |
| STRING | O43815. |
PTM databases | |
| PhosphoSite | O43815. |
Proteomic databases | |
| PRIDE | O43815. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000263918; ENSP00000263918; ENSG00000115808. |
| GeneID | 6801. |
| KEGG | hsa:6801. |
| UCSC | uc002rpn.1. human. uc010ezx.1. human. |
Organism-specific databases | |
| CTD | 6801. |
| GeneCards | GC02M036987. |
| H-InvDB | HIX0001969. |
| HGNC | HGNC:11424. STRN. |
| HPA | HPA017286. |
| neXtProt | NX_O43815. |
| PharmGKB | PA36224. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10459. |
| HOGENOM | HBG385782. |
| HOVERGEN | HBG007117. |
| InParanoid | O43815. |
| OMA | FIMGTDE. |
| OrthoDB | EOG43N7C6. |
| PhylomeDB | O43815. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | er_nongenomic_pathway. Plasma membrane estrogen receptor signaling. |
Gene expression databases | |
| ArrayExpress | O43815. |
| Bgee | O43815. |
| CleanEx | HS_STRN. |
| Genevestigator | O43815. |
| GermOnline | ENSG00000115808. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR020472. G-protein_beta_WD-40_rep. IPR013258. Striatin_N. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR011046. WD40_repeat-like_dom. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. [Graphical view] |
| Gene3D | G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 1 hit. |
| Pfam | PF08232. Striatin. 1 hit. PF00400. WD40. 5 hits. [Graphical view] |
| PRINTS | PR00320. GPROTEINBRPT. |
| SMART | SM00320. WD40. 6 hits. [Graphical view] |
| SUPFAM | SSF50978. WD40_like. 1 hit. |
| PROSITE | PS00678. WD_REPEATS_1. 4 hits. PS50082. WD_REPEATS_2. 4 hits. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 26559. |
| PMAP-CutDB | O43815. |
Entry information
| Entry name | STRN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43815 Secondary accession number(s): Q3KP65, Q53TQ8, Q9NP38 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with