Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Striatin

Gene

STRN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Calmodulin-binding protein which may function as scaffolding or signaling protein and may play a role in dendritic Ca2+ signaling.

GO - Molecular functioni

  • armadillo repeat domain binding Source: UniProtKB
  • calmodulin binding Source: UniProtKB
  • estrogen receptor binding Source: UniProtKB
  • protein-containing complex binding Source: UniProtKB
  • protein phosphatase 2A binding Source: UniProtKB

GO - Biological processi

  • bicellular tight junction assembly Source: UniProtKB
  • dendrite development Source: UniProtKB
  • locomotory behavior Source: UniProtKB
  • negative regulation of cell proliferation Source: UniProtKB
  • Wnt signaling pathway Source: UniProtKB

Keywordsi

Molecular functionCalmodulin-binding

Enzyme and pathway databases

SignaLinkiO43815

Names & Taxonomyi

Protein namesi
Recommended name:
Striatin
Gene namesi
Name:STRN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000115808.11
HGNCiHGNC:11424 STRN
MIMi614765 gene
neXtProtiNX_O43815

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi6801
OpenTargetsiENSG00000115808
PharmGKBiPA36224

Polymorphism and mutation databases

BioMutaiSTRN

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000512321 – 780StriatinAdd BLAST780

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei137PhosphoserineBy similarity1
Modified residuei225PhosphothreonineBy similarity1
Modified residuei227PhosphoserineCombined sources1
Modified residuei229PhosphoserineCombined sources1
Modified residuei245PhosphoserineCombined sources1
Modified residuei259PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO43815
MaxQBiO43815
PaxDbiO43815
PeptideAtlasiO43815
PRIDEiO43815

PTM databases

iPTMnetiO43815
PhosphoSitePlusiO43815

Miscellaneous databases

PMAP-CutDBiO43815

Expressioni

Tissue specificityi

Preferentially expressed in brain.1 Publication

Gene expression databases

BgeeiENSG00000115808
CleanExiHS_STRN
GenevisibleiO43815 HS

Organism-specific databases

HPAiHPA017286

Interactioni

Subunit structurei

Interacts with protein phosphatase 2A (PP2A) (Potential). Interacts with CTTNBP2; this interaction may regulate dendritic spine distribution of STRN. Activation of glutamate receptors weakens the interaction with CTTNBP2 (By similarity).By similarityCurated

Binary interactionsi

Show more details

GO - Molecular functioni

  • armadillo repeat domain binding Source: UniProtKB
  • calmodulin binding Source: UniProtKB
  • estrogen receptor binding Source: UniProtKB
  • protein phosphatase 2A binding Source: UniProtKB

Protein-protein interaction databases

BioGridi112674, 91 interactors
CORUMiO43815
ELMiO43815
IntActiO43815, 64 interactors
STRINGi9606.ENSP00000263918

Structurei

3D structure databases

ProteinModelPortaliO43815
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati461 – 500WD 1Add BLAST40
Repeati514 – 553WD 2Add BLAST40
Repeati567 – 606WD 3Add BLAST40
Repeati662 – 701WD 4Add BLAST40
Repeati704 – 743WD 5Add BLAST40
Repeati750 – 779WD 6Add BLAST30

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni55 – 63Caveolin-bindingSequence analysis9
Regioni149 – 166Calmodulin-bindingSequence analysisAdd BLAST18

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili53 – 120Sequence analysisAdd BLAST68

Sequence similaritiesi

Belongs to the WD repeat striatin family.Curated

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0642 Eukaryota
ENOG410XR31 LUCA
GeneTreeiENSGT00520000055597
HOGENOMiHOG000236343
HOVERGENiHBG007117
InParanoidiO43815
KOiK17608
OMAiFNMETRQ
OrthoDBiEOG091G0509
PhylomeDBiO43815
TreeFamiTF313387

Family and domain databases

Gene3Di2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR013258 Striatin_N
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF08232 Striatin, 1 hit
PF00400 WD40, 5 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00320 WD40, 6 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 4 hits
PS50082 WD_REPEATS_2, 4 hits
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43815-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEQAGPGVF FSNNHPGAGG AKGLGPLAEA AAAGDGAAAA GAARAQYSLP
60 70 80 90 100
GILHFLQHEW ARFEVERAQW EVERAELQAQ IAFLQGERKG QENLKKDLVR
110 120 130 140 150
RIKMLEYALK QERAKYHKLK YGTELNQGDM KPPSYDSDEG NETEVQPQQN
160 170 180 190 200
SQLMWKQGRQ LLRQYLQEVG YTDTILDVKS KRVRALLGFS SDVTDREDDK
210 220 230 240 250
NQDSVVNGTE AEVKETAMIA KSELTDSASV LDNFKFLESA AADFSDEDED
260 270 280 290 300
DDVDGREKSV IDTSTIVRKK ALPDSGEDRD TKEALKEFDF LVTSEEGDNE
310 320 330 340 350
SRSAGDGTDW EKEDQCLMPE AWNVDQGVIT KLKEQYKKER KGKKGVKRPN
360 370 380 390 400
RSKLQDMLAN LRDVDELPSL QPSVGSPSRP SSSRLPEHEI NRADEVEALT
410 420 430 440 450
FPPSSGKSFI MGADEALESE LGLGELAGLT VANEADSLTY DIANNKDALR
460 470 480 490 500
KTWNPKFTLR SHFDGIRALA FHPIEPVLIT ASEDHTLKMW NLQKTAPAKK
510 520 530 540 550
STSLDVEPIY TFRAHKGPVL CVVMSSNGEQ CYSGGTDGLI QGWNTTNPNI
560 570 580 590 600
DPYDSYDPSV LRGPLLGHTD AVWGLAYSAA HQRLLSCSAD GTLRLWNTTE
610 620 630 640 650
VAPALSVFND TKELGIPASV DLVSSDPSHM VASFSKGYTS IFNMETQQRI
660 670 680 690 700
LTLESNVDTT ANSSCQINRV ISHPTLPISI TAHEDRHIKF YDNNTGKLIH
710 720 730 740 750
SMVAHLEAVT SLAVDPNGLY LMSGSHDCSI RLWNLESKTC IQEFTAHRKK
760 770 780
FEESIHDVAF HPSKCYIASA GADALAKVFV
Length:780
Mass (Da):86,132
Last modified:March 6, 2007 - v4
Checksum:iDDB18A11102BEA35
GO
Isoform 2 (identifier: O43815-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-40: Missing.
     311-348: EKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKR → G

Note: No experimental confirmation available.
Show »
Length:731
Mass (Da):80,761
Checksum:i67B5DD94E3499AB7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti191S → I in CAA11560 (PubMed:9693043).Curated1
Sequence conflicti423L → P in CAA11560 (PubMed:9693043).Curated1
Sequence conflicti611T → I in CAA11560 (PubMed:9693043).Curated1
Sequence conflicti677P → S in CAA11560 (PubMed:9693043).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02349529 – 40Missing in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_023496311 – 348EKEDQ…KGVKR → G in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ223814 mRNA Translation: CAA11560.1
AC007404 Genomic DNA Translation: AAY24273.1
AC007382 Genomic DNA Translation: AAF66162.1
BC106879 mRNA Translation: AAI06880.1
CCDSiCCDS1784.1 [O43815-1]
RefSeqiNP_003153.2, NM_003162.3 [O43815-1]
UniGeneiHs.127486

Genome annotation databases

EnsembliENST00000263918; ENSP00000263918; ENSG00000115808 [O43815-1]
ENST00000379213; ENSP00000368513; ENSG00000115808 [O43815-2]
GeneIDi6801
KEGGihsa:6801
UCSCiuc002rpn.4 human [O43815-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSTRN_HUMAN
AccessioniPrimary (citable) accession number: O43815
Secondary accession number(s): Q3KP65, Q53TQ8, Q9NP38
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: March 6, 2007
Last modified: April 25, 2018
This is version 169 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health