Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Asparagine--tRNA ligase, cytoplasmic

Gene

NARS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + L-asparagine + tRNA(Asn) = AMP + diphosphate + L-asparaginyl-tRNA(Asn).

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionAminoacyl-tRNA synthetase, Ligase
Biological processProtein biosynthesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi6.1.1.22 2681
ReactomeiR-HSA-379716 Cytosolic tRNA aminoacylation

Names & Taxonomyi

Protein namesi
Recommended name:
Asparagine--tRNA ligase, cytoplasmic (EC:6.1.1.22)
Alternative name(s):
Asparaginyl-tRNA synthetase
Short name:
AsnRS
Gene namesi
Name:NARS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

EuPathDBiHostDB:ENSG00000134440.11
HGNCiHGNC:7643 NARS
MIMi108410 gene
neXtProtiNX_O43776

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi4677
OpenTargetsiENSG00000134440
PharmGKBiPA31447

Chemistry databases

DrugBankiDB00174 L-Asparagine

Polymorphism and mutation databases

BioMutaiNARS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001764961 – 548Asparagine--tRNA ligase, cytoplasmicAdd BLAST548

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei61PhosphoserineCombined sources1
Modified residuei244N6-acetyllysineCombined sources1
Modified residuei482PhosphoserineBy similarity1
Modified residuei490N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO43776
MaxQBiO43776
PaxDbiO43776
PeptideAtlasiO43776
PRIDEiO43776

PTM databases

iPTMnetiO43776
PhosphoSitePlusiO43776
SwissPalmiO43776

Expressioni

Gene expression databases

BgeeiENSG00000134440
CleanExiHS_ASNS
HS_NARS
ExpressionAtlasiO43776 baseline and differential
GenevisibleiO43776 HS

Organism-specific databases

HPAiCAB034257
HPA040017

Interactioni

Protein-protein interaction databases

BioGridi110758, 67 interactors
IntActiO43776, 13 interactors
MINTiO43776
STRINGi9606.ENSP00000256854

Structurei

Secondary structure

1548
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi5 – 8Combined sources4
Turni10 – 12Combined sources3
Turni15 – 17Combined sources3
Beta strandi20 – 24Combined sources5
Helixi29 – 34Combined sources6
Beta strandi38 – 40Combined sources3
Beta strandi43 – 47Combined sources5
Beta strandi55 – 57Combined sources3
Helixi60 – 73Combined sources14

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4ZYAX-ray1.65A/B4-77[»]
ProteinModelPortaliO43776
SMRiO43776
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0555 Eukaryota
COG0017 LUCA
GeneTreeiENSGT00550000074893
HOGENOMiHOG000226035
HOVERGENiHBG059844
InParanoidiO43776
KOiK01893
OMAiYMQRCPE
OrthoDBiEOG091G065Q
PhylomeDBiO43776
TreeFamiTF105664

Family and domain databases

InterProiView protein in InterPro
IPR004364 aa-tRNA-synt_II
IPR006195 aa-tRNA-synth_II
IPR004522 Asn-tRNA-ligase
IPR002312 Asp/Asn-tRNA-synth_IIb
IPR012340 NA-bd_OB-fold
IPR004365 NA-bd_OB_tRNA
PfamiView protein in Pfam
PF00152 tRNA-synt_2, 1 hit
PF01336 tRNA_anti-codon, 1 hit
PRINTSiPR01042 TRNASYNTHASP
SUPFAMiSSF50249 SSF50249, 1 hit
TIGRFAMsiTIGR00457 asnS, 1 hit
PROSITEiView protein in PROSITE
PS50862 AA_TRNA_LIGASE_II, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43776-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVLAELYVSD REGSDATGDG TKEKPFKTGL KALMTVGKEP FPTIYVDSQK
60 70 80 90 100
ENERWNVISK SQLKNIKKMW HREQMKSESR EKKEAEDSLR REKNLEEAKK
110 120 130 140 150
ITIKNDPSLP EPKCVKIGAL EGYRGQRVKV FGWVHRLRRQ GKNLMFLVLR
160 170 180 190 200
DGTGYLQCVL ADELCQCYNG VLLSTESSVA VYGMLNLTPK GKQAPGGHEL
210 220 230 240 250
SCDFWELIGL APAGGADNLI NEESDVDVQL NNRHMMIRGE NMSKILKARS
260 270 280 290 300
MVTRCFRDHF FDRGYYEVTP PTLVQTQVEG GATLFKLDYF GEEAFLTQSS
310 320 330 340 350
QLYLETCLPA LGDVFCIAQS YRAEQSRTRR HLAEYTHVEA ECPFLTFDDL
360 370 380 390 400
LNRLEDLVCD VVDRILKSPA GSIVHELNPN FQPPKRPFKR MNYSDAIVWL
410 420 430 440 450
KEHDVKKEDG TFYEFGEDIP EAPERLMTDT INEPILLCRF PVEIKSFYMQ
460 470 480 490 500
RCPEDSRLTE SVDVLMPNVG EIVGGSMRIF DSEEILAGYK REGIDPTPYY
510 520 530 540
WYTDQRKYGT CPHGGYGLGL ERFLTWILNR YHIRDVCLYP RFVQRCTP
Length:548
Mass (Da):62,943
Last modified:June 1, 1998 - v1
Checksum:iCDD442C4E962CDDB
GO
Isoform 2 (identifier: O43776-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-173: GKNLMFLVLRDGTGYLQCVLADELCQCYNGVLL → VSVLQWSSLVHGEQCCSVWNAKSYPKGQAGSRW
     174-547: Missing.

Note: No experimental confirmation available.
Show »
Length:174
Mass (Da):20,033
Checksum:i594E9ED90ED09E4B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti391M → V in BAD96555 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056201141 – 173GKNLM…NGVLL → VSVLQWSSLVHGEQCCSVWN AKSYPKGQAGSRW in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_056202174 – 547Missing in isoform 2. 1 PublicationAdd BLAST374

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ000334 mRNA Translation: CAA04008.1
D84273 mRNA Translation: BAA34600.1
AK294364 mRNA Translation: BAG57627.1
AC100847 Genomic DNA No translation available.
AK222835 mRNA Translation: BAD96555.1
BC001687 mRNA Translation: AAH01687.1
CCDSiCCDS32837.1 [O43776-1]
RefSeqiNP_004530.1, NM_004539.3 [O43776-1]
UniGeneiHs.465224

Genome annotation databases

EnsembliENST00000256854; ENSP00000256854; ENSG00000134440 [O43776-1]
ENST00000540592; ENSP00000442496; ENSG00000134440 [O43776-2]
GeneIDi4677
KEGGihsa:4677
UCSCiuc002lgs.4 human [O43776-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSYNC_HUMAN
AccessioniPrimary (citable) accession number: O43776
Secondary accession number(s): B4DG16, Q53GU6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: June 1, 1998
Last modified: March 28, 2018
This is version 163 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health