O43759 (SNG1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Synaptogyrin-1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 233 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the regulation of short-term and long-term synaptic plasticity By similarity. |
| Subcellular location | Membrane; Multi-pass membrane protein. Melanosome. Cell junction › synapse. Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Ref.7 |
| Sequence similarities | Belongs to the synaptogyrin family. Contains 1 MARVEL domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Membrane Synapse |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein targeting Inferred from electronic annotation. Source: Compara regulation of long-term neuronal synaptic plasticityInferred from sequence or structural similarity. Source: UniProtKB regulation of short-term neuronal synaptic plasticityInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular_component | cell junction Inferred from electronic annotation. Source: UniProtKB-KW integral to membraneInferred from electronic annotation. Source: UniProtKB-KW melanosomeInferred from electronic annotation. Source: UniProtKB-SubCell synaptic vesicle membraneInferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1A (identifier: O43759-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1B (identifier: O43759-2) The sequence of this isoform differs from the canonical sequence as follows: 162-233: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKDLSFQEEYSTLFPASAQP | ||||||
| Isoform 1C (identifier: O43759-3) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSW → MLTLEFGILEFDPSWIGSWTQRSWVSWRSRPGCE 162-233: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKDLSFQEEYSTLFPASAQP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 233 | 233 | Synaptogyrin-1 | PRO_0000183990 | |||||
Regions | |||||||||
| Transmembrane | 24 – 44 | 21 | Helical; Potential | ||||||
| Transmembrane | 72 – 92 | 21 | Helical; Potential | ||||||
| Transmembrane | 104 – 124 | 21 | Helical; Potential | ||||||
| Transmembrane | 149 – 169 | 21 | Helical; Potential | ||||||
| Domain | 20 – 173 | 154 | MARVEL | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 33 | 33 | MEGGA…RVVSW → MLTLEFGILEFDPSWIGSWT QRSWVSWRSRPGCE in isoform 1C. | VSP_006331 | |||||
| Alternative sequence | 162 – 233 | 72 | AGQAV…QSQGY → SLTAALAVRRFKDLSFQEEY STLFPASAQP in isoform 1B and isoform 1C. | VSP_006332 | |||||
| Natural variant | 202 | 1 | P → PN. Ref.1 Ref.2 Ref.4 Ref.8 | VAR_060489 | |||||
| Natural variant | 222 | 1 | D → G in a patient affected by schizophrenia. Ref.8 | VAR_060490 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the human synaptogyrin gene family." Kedra D., Pan H.-Q., Seroussi E., Fransson I., Guilbaud C., Collins J.E., Dunham I., Blennow E., Roe B.A., Piehl F., Dumanski J.P. Hum. Genet. 103:131-141(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1A; 1B AND 1C), VARIANT ASN-202 INS. |
| [2] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1A), VARIANT ASN-202 INS. |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1B). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1A), VARIANT ASN-202 INS. Tissue: Cerebellum. |
| [5] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1B). Tissue: Brain. |
| [7] | "Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes." Chi A., Valencia J.C., Hu Z.-Z., Watabe H., Yamaguchi H., Mangini N.J., Huang H., Canfield V.A., Cheng K.C., Yang F., Abe R., Yamagishi S., Shabanowitz J., Hearing V.J., Wu C., Appella E., Hunt D.F. J. Proteome Res. 5:3135-3144(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. Tissue: Melanoma. |
| [8] | "Identification of rare mutations of synaptogyrin 1 gene in patients with schizophrenia." Cheng M.C., Chen C.H. J. Psychiatr. Res. 41:1027-1031(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASN-202 INS AND GLY-222. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ002303 mRNA. Translation: CAA05320.1. AJ002304 mRNA. Translation: CAA05321.1. AJ002305 mRNA. Translation: CAA05322.1. CR456590 mRNA. Translation: CAG30476.1. BT007135 mRNA. Translation: AAP35799.1. AK289507 mRNA. Translation: BAF82196.1. AL022326 Genomic DNA. Translation: CAA18452.1. BC000731 mRNA. Translation: AAH00731.1. |
| IPI | IPI00013940. IPI00178631. IPI00745347. |
| RefSeq | NP_004702.2. NM_004711.4. NP_663783.1. NM_145731.3. NP_663791.1. NM_145738.2. |
| UniGene | Hs.216226. |
3D structure databases | |
| ProteinModelPortal | O43759. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O43759. 1 interaction. |
| STRING | 9606.ENSP00000332287. |
PTM databases | |
| PhosphoSite | O43759. |
Proteomic databases | |
| PaxDb | O43759. |
| PRIDE | O43759. |
Protocols and materials databases | |
| DNASU | 9145. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000318801; ENSP00000318845; ENSG00000100321. ENST00000328933; ENSP00000332287; ENSG00000100321. ENST00000381535; ENSP00000370946; ENSG00000100321. |
| GeneID | 9145. |
| KEGG | hsa:9145. |
| UCSC | uc003axo.4. human. uc003axq.4. human. uc003axs.4. human. |
Organism-specific databases | |
| CTD | 9145. |
| GeneCards | GC22P039745. |
| HGNC | HGNC:11498. SYNGR1. |
| HPA | CAB034277. HPA029673. |
| MIM | 603925. gene. |
| neXtProt | NX_O43759. |
| PharmGKB | PA36280. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG306774. |
| HOVERGEN | HBG000896. |
| InParanoid | O43759. |
| OMA | CISSEGW. |
| PhylomeDB | O43759. |
Gene expression databases | |
| ArrayExpress | O43759. |
| Bgee | O43759. |
| CleanEx | HS_SYNGR1. |
| Genevestigator | O43759. |
| GermOnline | ENSG00000100321. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008253. Marvel. IPR021128. MARVEL-like_dom. IPR016579. Synaptogyrin. [Graphical view] |
| Pfam | PF01284. MARVEL. 1 hit. [Graphical view] |
| PIRSF | PIRSF011282. Synaptogyrin. 1 hit. |
| PROSITE | PS51225. MARVEL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SYNGR1. human. |
| GenomeRNAi | 9145. |
| NextBio | 34299. |
| SOURCE | Search... |
Entry information
| Entry name | SNG1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43759 Secondary accession number(s): A6NP69 Q9UGZ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
