Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptogyrin-1

Gene

SYNGR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the regulation of short-term and long-term synaptic plasticity.By similarity

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100321-MONOMER.
ReactomeiR-HSA-6798695. Neutrophil degranulation.

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptogyrin-1
Gene namesi
Name:SYNGR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:11498. SYNGR1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei24 – 44HelicalSequence analysisAdd BLAST21
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Transmembranei104 – 124HelicalSequence analysisAdd BLAST21
Transmembranei149 – 169HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi9145.
OpenTargetsiENSG00000100321.
PharmGKBiPA36280.

Polymorphism and mutation databases

BioMutaiSYNGR1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001839901 – 233Synaptogyrin-1Add BLAST233

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiO43759.
MaxQBiO43759.
PaxDbiO43759.
PeptideAtlasiO43759.
PRIDEiO43759.
TopDownProteomicsiO43759-1. [O43759-1]

PTM databases

iPTMnetiO43759.
PhosphoSitePlusiO43759.

Expressioni

Gene expression databases

BgeeiENSG00000100321.
CleanExiHS_SYNGR1.
ExpressionAtlasiO43759. baseline and differential.
GenevisibleiO43759. HS.

Organism-specific databases

HPAiCAB034277.
HPA029673.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
FATE1Q969F03EBI-6269521,EBI-743099

Protein-protein interaction databases

BioGridi114592. 4 interactors.
IntActiO43759. 4 interactors.
STRINGi9606.ENSP00000332287.

Structurei

3D structure databases

ProteinModelPortaliO43759.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 173MARVELPROSITE-ProRule annotationAdd BLAST154

Sequence similaritiesi

Belongs to the synaptogyrin family.Curated
Contains 1 MARVEL domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4016. Eukaryota.
ENOG4111F8S. LUCA.
GeneTreeiENSGT00510000046450.
HOVERGENiHBG000896.
InParanoidiO43759.
OMAiWSQWSSA.
OrthoDBiEOG091G0KKK.
PhylomeDBiO43759.
TreeFamiTF320995.

Family and domain databases

InterProiIPR008253. Marvel.
IPR016579. Synaptogyrin.
[Graphical view]
PANTHERiPTHR10838. PTHR10838. 1 hit.
PfamiPF01284. MARVEL. 1 hit.
[Graphical view]
PIRSFiPIRSF011282. Synaptogyrin. 1 hit.
PROSITEiPS51225. MARVEL. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1A (identifier: O43759-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGGAYGAGK AGGAFDPYTL VRQPHTILRV VSWLFSIVVF GSIVNEGYLN
60 70 80 90 100
SASEGEEFCI YNRNPNACSY GVAVGVLAFL TCLLYLALDV YFPQISSVKD
110 120 130 140 150
RKKAVLSDIG VSAFWAFLWF VGFCYLANQW QVSKPKDNPL NEGTDAARAA
160 170 180 190 200
IAFSFFSIFT WAGQAVLAFQ RYQIGADSAL FSQDYMDPSQ DSSMPYAPYV
210 220 230
EPTGPDPAGM GGTYQQPANT FDTEPQGYQS QGY
Length:233
Mass (Da):25,456
Last modified:October 3, 2006 - v2
Checksum:i8DE7000A46960213
GO
Isoform 1B (identifier: O43759-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-233: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKDLSFQEEYSTLFPASAQP

Show »
Length:191
Mass (Da):21,038
Checksum:iB620694C3DAEF56C
GO
Isoform 1C (identifier: O43759-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSW → MLTLEFGILEFDPSWIGSWTQRSWVSWRSRPGCE
     162-233: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKDLSFQEEYSTLFPASAQP

Show »
Length:192
Mass (Da):21,591
Checksum:i2C42A04B3D8DDAA6
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_060489202P → PN.4 Publications1
Natural variantiVAR_060490222D → G in a patient affected by schizophrenia. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0063311 – 33MEGGA…RVVSW → MLTLEFGILEFDPSWIGSWT QRSWVSWRSRPGCE in isoform 1C. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_006332162 – 233AGQAV…QSQGY → SLTAALAVRRFKDLSFQEEY STLFPASAQP in isoform 1B and isoform 1C. 3 PublicationsAdd BLAST72

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002303 mRNA. Translation: CAA05320.1.
AJ002304 mRNA. Translation: CAA05321.1.
AJ002305 mRNA. Translation: CAA05322.1.
CR456590 mRNA. Translation: CAG30476.1.
BT007135 mRNA. Translation: AAP35799.1.
AK289507 mRNA. Translation: BAF82196.1.
AL022326 Genomic DNA. Translation: CAA18452.1.
BC000731 mRNA. Translation: AAH00731.1.
CCDSiCCDS13989.1. [O43759-1]
CCDS13990.1. [O43759-2]
CCDS13991.1. [O43759-3]
RefSeqiNP_004702.2. NM_004711.4. [O43759-1]
NP_663783.1. NM_145731.3. [O43759-2]
NP_663791.1. NM_145738.2. [O43759-3]
UniGeneiHs.216226.

Genome annotation databases

EnsembliENST00000318801; ENSP00000318845; ENSG00000100321. [O43759-2]
ENST00000328933; ENSP00000332287; ENSG00000100321. [O43759-1]
ENST00000381535; ENSP00000370946; ENSG00000100321. [O43759-3]
GeneIDi9145.
KEGGihsa:9145.
UCSCiuc003axo.5. human. [O43759-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002303 mRNA. Translation: CAA05320.1.
AJ002304 mRNA. Translation: CAA05321.1.
AJ002305 mRNA. Translation: CAA05322.1.
CR456590 mRNA. Translation: CAG30476.1.
BT007135 mRNA. Translation: AAP35799.1.
AK289507 mRNA. Translation: BAF82196.1.
AL022326 Genomic DNA. Translation: CAA18452.1.
BC000731 mRNA. Translation: AAH00731.1.
CCDSiCCDS13989.1. [O43759-1]
CCDS13990.1. [O43759-2]
CCDS13991.1. [O43759-3]
RefSeqiNP_004702.2. NM_004711.4. [O43759-1]
NP_663783.1. NM_145731.3. [O43759-2]
NP_663791.1. NM_145738.2. [O43759-3]
UniGeneiHs.216226.

3D structure databases

ProteinModelPortaliO43759.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114592. 4 interactors.
IntActiO43759. 4 interactors.
STRINGi9606.ENSP00000332287.

PTM databases

iPTMnetiO43759.
PhosphoSitePlusiO43759.

Polymorphism and mutation databases

BioMutaiSYNGR1.

Proteomic databases

EPDiO43759.
MaxQBiO43759.
PaxDbiO43759.
PeptideAtlasiO43759.
PRIDEiO43759.
TopDownProteomicsiO43759-1. [O43759-1]

Protocols and materials databases

DNASUi9145.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318801; ENSP00000318845; ENSG00000100321. [O43759-2]
ENST00000328933; ENSP00000332287; ENSG00000100321. [O43759-1]
ENST00000381535; ENSP00000370946; ENSG00000100321. [O43759-3]
GeneIDi9145.
KEGGihsa:9145.
UCSCiuc003axo.5. human. [O43759-1]

Organism-specific databases

CTDi9145.
DisGeNETi9145.
GeneCardsiSYNGR1.
HGNCiHGNC:11498. SYNGR1.
HPAiCAB034277.
HPA029673.
MIMi603925. gene.
neXtProtiNX_O43759.
OpenTargetsiENSG00000100321.
PharmGKBiPA36280.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4016. Eukaryota.
ENOG4111F8S. LUCA.
GeneTreeiENSGT00510000046450.
HOVERGENiHBG000896.
InParanoidiO43759.
OMAiWSQWSSA.
OrthoDBiEOG091G0KKK.
PhylomeDBiO43759.
TreeFamiTF320995.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100321-MONOMER.
ReactomeiR-HSA-6798695. Neutrophil degranulation.

Miscellaneous databases

ChiTaRSiSYNGR1. human.
GeneWikiiSYNGR1.
GenomeRNAii9145.
PROiO43759.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100321.
CleanExiHS_SYNGR1.
ExpressionAtlasiO43759. baseline and differential.
GenevisibleiO43759. HS.

Family and domain databases

InterProiIPR008253. Marvel.
IPR016579. Synaptogyrin.
[Graphical view]
PANTHERiPTHR10838. PTHR10838. 1 hit.
PfamiPF01284. MARVEL. 1 hit.
[Graphical view]
PIRSFiPIRSF011282. Synaptogyrin. 1 hit.
PROSITEiPS51225. MARVEL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSNG1_HUMAN
AccessioniPrimary (citable) accession number: O43759
Secondary accession number(s): A6NP69
, A8K0E2, O43757, O43758, Q53Y02, Q96J56, Q9UGZ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 3, 2006
Last modified: November 30, 2016
This is version 139 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.