Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sialic acid-binding Ig-like lectin 6

Gene

SIGLEC6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei122 – 1221Sialic acidBy similarity

GO - Molecular functioni

GO - Biological processi

  • cell adhesion Source: UniProtKB-KW
  • cell-cell signaling Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Lectin

Enzyme and pathway databases

ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Names & Taxonomyi

Protein namesi
Recommended name:
Sialic acid-binding Ig-like lectin 6
Short name:
Siglec-6
Alternative name(s):
CD33 antigen-like 1
CDw327
Obesity-binding protein 1
Short name:
OB-BP1
CD_antigen: CD327
Gene namesi
Name:SIGLEC6
Synonyms:CD33L, CD33L1, OBBP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:10875. SIGLEC6.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini27 – 347321ExtracellularSequence analysisAdd
BLAST
Transmembranei348 – 36821HelicalSequence analysisAdd
BLAST
Topological domaini369 – 45385CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • extracellular region Source: UniProtKB-SubCell
  • integral component of plasma membrane Source: ProtInc
  • membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35776.

Polymorphism and mutation databases

BioMutaiSIGLEC6.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2626Sequence analysisAdd
BLAST
Chaini27 – 453427Sialic acid-binding Ig-like lectin 6PRO_0000014946Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi46 ↔ 172PROSITE-ProRule annotation
Disulfide bondi51 ↔ 104PROSITE-ProRule annotation
Glycosylationi103 – 1031N-linked (GlcNAc...)Sequence analysis
Glycosylationi149 – 1491N-linked (GlcNAc...)Sequence analysis
Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence analysis
Disulfide bondi166 ↔ 215PROSITE-ProRule annotation
Glycosylationi233 – 2331N-linked (GlcNAc...)Sequence analysis
Disulfide bondi274 ↔ 319PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO43699.
PRIDEiO43699.

PTM databases

iPTMnetiO43699.
PhosphoSiteiO43699.

Expressioni

Tissue specificityi

Expressed at high levels in placenta (cyto- and syncytiotrophoblastic cells) and at lower levels in spleen, peripheral blood leukocytes (predominantly B-cells) and small intestine.

Gene expression databases

BgeeiO43699.
CleanExiHS_SIGLEC6.
ExpressionAtlasiO43699. baseline and differential.
GenevisibleiO43699. HS.

Organism-specific databases

HPAiHPA009084.
HPA018198.

Interactioni

Subunit structurei

Interacts with LEP.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FHL2Q141923EBI-2814604,EBI-701903
TCF4P158843EBI-2814604,EBI-533224

Protein-protein interaction databases

BioGridi107384. 3 interactions.
IntActiO43699. 4 interactions.
STRINGi9606.ENSP00000401502.

Structurei

3D structure databases

ProteinModelPortaliO43699.
SMRiO43699. Positions 31-340.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini28 – 12396Ig-like V-typeAdd
BLAST
Domaini148 – 23184Ig-like C2-type 1Add
BLAST
Domaini238 – 33396Ig-like C2-type 2Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi424 – 4296ITIM motif
Motifi444 – 4496SLAM-like motif

Domaini

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJT6. Eukaryota.
ENOG410YKZU. LUCA.
GeneTreeiENSGT00760000119139.
HOGENOMiHOG000236324.
HOVERGENiHBG036161.
InParanoidiO43699.
KOiK06738.
OMAiGYWFLEG.
OrthoDBiEOG73JKV5.
PhylomeDBiO43699.
TreeFamiTF332441.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR013151. Immunoglobulin.
[Graphical view]
PfamiPF07679. I-set. 1 hit.
PF00047. ig. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 3 hits.
SM00408. IGc2. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 3 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43699-1) [UniParc]FASTAAdd to basket

Also known as: Membrane-bound, CD33L1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQGAQEASAS EMLPLLLPLL WAGALAQERR FQLEGPESLT VQEGLCVLVP
60 70 80 90 100
CRLPTTLPAS YYGYGYWFLE GADVPVATND PDEEVQEETR GRFHLLWDPR
110 120 130 140 150
RKNCSLSIRD ARRRDNAAYF FRLKSKWMKY GYTSSKLSVR VMALTHRPNI
160 170 180 190 200
SIPGTLESGH PSNLTCSVPW VCEQGTPPIF SWMSAAPTSL GPRTTQSSVL
210 220 230 240 250
TITPRPQDHS TNLTCQVTFP GAGVTMERTI QLNVSYAPQK VAISIFQGNS
260 270 280 290 300
AAFKILQNTS SLPVLEGQAL RLLCDADGNP PAHLSWFQGF PALNATPISN
310 320 330 340 350
TGVLELPQVG SAEEGDFTCR AQHPLGSLQI SLSLFVHWKP EGRAGGVLGA
360 370 380 390 400
VWGASITTLV FLCVCFIFRV KTRRKKAAQP VQNTDDVNPV MVSGSRGHQH
410 420 430 440 450
QFQTGIVSDH PAEAGPISED EQELHYAVLH FHKVQPQEPK VTDTEYSEIK

IHK
Length:453
Mass (Da):49,913
Last modified:November 25, 2008 - v2
Checksum:i9DD7FBD8F059E452
GO
Isoform 2 (identifier: O43699-2) [UniParc]FASTAAdd to basket

Also known as: Secreted, CD33L2

The sequence of this isoform differs from the canonical sequence as follows:
     339-391: KPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVM → SSAPVPDRHSFRPPC
     392-453: Missing.

Note: Should not be confused with SIGLEC5 which has been called CD33L2.
Show »
Length:353
Mass (Da):38,808
Checksum:i4B92E4AEE7F85F4A
GO
Isoform 3 (identifier: O43699-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     236-252: YAPQKVAISIFQGNSAA → S

Note: No experimental confirmation available.
Show »
Length:437
Mass (Da):48,253
Checksum:i7F8019D0A7B4F8CA
GO
Isoform 4 (identifier: O43699-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     143-153: Missing.
     339-391: KPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVM → SSAPVPDRHSFRPPC
     392-453: Missing.

Note: No experimental confirmation available.
Show »
Length:342
Mass (Da):37,608
Checksum:iA954E3391E2789CE
GO
Isoform 5 (identifier: O43699-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     236-236: Y → WMLRRPPLSTPD
     371-453: KTRRKKAAQP...TEYSEIKIHK → ISTSSRQA

Note: No experimental confirmation available.Curated
Show »
Length:389
Mass (Da):42,642
Checksum:iC1BB8F4042F8FB03
GO
Isoform 6 (identifier: O43699-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     23-58: Missing.
     236-252: YAPQKVAISIFQGNSAA → S

Note: No experimental confirmation available.
Show »
Length:401
Mass (Da):44,348
Checksum:i3F487B113CADB0C4
GO

Sequence cautioni

The sequence AAB70702.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAH35359.2 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAI40799.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAA24983.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAA24984.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti6 – 61E → K in BAA24983 (PubMed:9465907).Curated
Sequence conflicti6 – 61E → K in BAA24984 (PubMed:9465907).Curated
Sequence conflicti137 – 1382LS → IY in AAB70702 (PubMed:10428856).Curated
Sequence conflicti155 – 1617TLESGHP → PGVWPS in AAB70702 (PubMed:10428856).Curated
Sequence conflicti183 – 1831M → T in AK300170 (PubMed:14702039).Curated
Sequence conflicti188 – 1892TS → HL in AAB70702 (PubMed:10428856).Curated
Sequence conflicti205 – 2062RP → A in AAB70702 (PubMed:10428856).Curated
Sequence conflicti389 – 3891P → L in AK300170 (PubMed:14702039).Curated
Isoform 5 (identifier: O43699-5)
Sequence conflicti246 – 2461P → S in AK300182 (PubMed:10428856).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti57 – 571L → V.1 Publication
Corresponds to variant rs2305773 [ dbSNP | Ensembl ].
VAR_014252
Natural varianti262 – 2621L → F.
Corresponds to variant rs2005199 [ dbSNP | Ensembl ].
VAR_014253

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei23 – 5836Missing in isoform 6. 1 PublicationVSP_046070Add
BLAST
Alternative sequencei143 – 15311Missing in isoform 4. 1 PublicationVSP_035811Add
BLAST
Alternative sequencei236 – 25217YAPQK…GNSAA → S in isoform 3 and isoform 6. 2 PublicationsVSP_035812Add
BLAST
Alternative sequencei236 – 2361Y → WMLRRPPLSTPD in isoform 5. 1 PublicationVSP_045387
Alternative sequencei339 – 39153KPEGR…VNPVM → SSAPVPDRHSFRPPC in isoform 2 and isoform 4. 2 PublicationsVSP_002553Add
BLAST
Alternative sequencei371 – 45383KTRRK…IKIHK → ISTSSRQA in isoform 5. 1 PublicationVSP_045388Add
BLAST
Alternative sequencei392 – 45362Missing in isoform 2 and isoform 4. 2 PublicationsVSP_002554Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D86358 mRNA. Translation: BAA24983.1. Different initiation.
D86359 mRNA. Translation: BAA24984.1. Different initiation.
AK300170 mRNA. No translation available.
AK300182 mRNA. No translation available.
AC020914 Genomic DNA. No translation available.
BC035359 mRNA. Translation: AAH35359.2. Different initiation.
BC140798 mRNA. Translation: AAI40799.1. Different initiation.
U71382 mRNA. Translation: AAB70702.1. Different initiation.
CCDSiCCDS12834.3. [O43699-1]
CCDS12835.3. [O43699-3]
CCDS12836.3. [O43699-2]
CCDS54307.1. [O43699-6]
CCDS54308.1. [O43699-5]
CCDS59417.1. [O43699-4]
RefSeqiNP_001171018.1. NM_001177547.1. [O43699-6]
NP_001171019.1. NM_001177548.1. [O43699-5]
NP_001171020.1. NM_001177549.1. [O43699-4]
NP_001236.4. NM_001245.5. [O43699-1]
NP_942142.3. NM_198845.4. [O43699-3]
NP_942143.3. NM_198846.4. [O43699-2]
UniGeneiHs.720304.

Genome annotation databases

EnsembliENST00000343300; ENSP00000345907; ENSG00000105492. [O43699-2]
ENST00000346477; ENSP00000344064; ENSG00000105492. [O43699-3]
ENST00000359982; ENSP00000353071; ENSG00000105492. [O43699-5]
ENST00000391797; ENSP00000375674; ENSG00000105492. [O43699-4]
ENST00000425629; ENSP00000401502; ENSG00000105492. [O43699-1]
ENST00000436458; ENSP00000410679; ENSG00000105492. [O43699-6]
GeneIDi946.
KEGGihsa:946.
UCSCiuc002pwy.4. human. [O43699-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Siglec-6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D86358 mRNA. Translation: BAA24983.1. Different initiation.
D86359 mRNA. Translation: BAA24984.1. Different initiation.
AK300170 mRNA. No translation available.
AK300182 mRNA. No translation available.
AC020914 Genomic DNA. No translation available.
BC035359 mRNA. Translation: AAH35359.2. Different initiation.
BC140798 mRNA. Translation: AAI40799.1. Different initiation.
U71382 mRNA. Translation: AAB70702.1. Different initiation.
CCDSiCCDS12834.3. [O43699-1]
CCDS12835.3. [O43699-3]
CCDS12836.3. [O43699-2]
CCDS54307.1. [O43699-6]
CCDS54308.1. [O43699-5]
CCDS59417.1. [O43699-4]
RefSeqiNP_001171018.1. NM_001177547.1. [O43699-6]
NP_001171019.1. NM_001177548.1. [O43699-5]
NP_001171020.1. NM_001177549.1. [O43699-4]
NP_001236.4. NM_001245.5. [O43699-1]
NP_942142.3. NM_198845.4. [O43699-3]
NP_942143.3. NM_198846.4. [O43699-2]
UniGeneiHs.720304.

3D structure databases

ProteinModelPortaliO43699.
SMRiO43699. Positions 31-340.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107384. 3 interactions.
IntActiO43699. 4 interactions.
STRINGi9606.ENSP00000401502.

PTM databases

iPTMnetiO43699.
PhosphoSiteiO43699.

Polymorphism and mutation databases

BioMutaiSIGLEC6.

Proteomic databases

PaxDbiO43699.
PRIDEiO43699.

Protocols and materials databases

DNASUi946.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343300; ENSP00000345907; ENSG00000105492. [O43699-2]
ENST00000346477; ENSP00000344064; ENSG00000105492. [O43699-3]
ENST00000359982; ENSP00000353071; ENSG00000105492. [O43699-5]
ENST00000391797; ENSP00000375674; ENSG00000105492. [O43699-4]
ENST00000425629; ENSP00000401502; ENSG00000105492. [O43699-1]
ENST00000436458; ENSP00000410679; ENSG00000105492. [O43699-6]
GeneIDi946.
KEGGihsa:946.
UCSCiuc002pwy.4. human. [O43699-1]

Organism-specific databases

CTDi946.
GeneCardsiSIGLEC6.
HGNCiHGNC:10875. SIGLEC6.
HPAiHPA009084.
HPA018198.
MIMi604405. gene.
neXtProtiNX_O43699.
PharmGKBiPA35776.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJT6. Eukaryota.
ENOG410YKZU. LUCA.
GeneTreeiENSGT00760000119139.
HOGENOMiHOG000236324.
HOVERGENiHBG036161.
InParanoidiO43699.
KOiK06738.
OMAiGYWFLEG.
OrthoDBiEOG73JKV5.
PhylomeDBiO43699.
TreeFamiTF332441.

Enzyme and pathway databases

ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Miscellaneous databases

GenomeRNAii946.
NextBioi3924.
PROiO43699.
SOURCEiSearch...

Gene expression databases

BgeeiO43699.
CleanExiHS_SIGLEC6.
ExpressionAtlasiO43699. baseline and differential.
GenevisibleiO43699. HS.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR013151. Immunoglobulin.
[Graphical view]
PfamiPF07679. I-set. 1 hit.
PF00047. ig. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 3 hits.
SM00408. IGc2. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 3 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of a novel gene similar to myeloid antigen CD33 and its specific expression in placenta."
    Takei Y., Sasaki S., Fujiwara T., Takahashi E., Muto T., Nakamura Y.
    Cytogenet. Cell Genet. 78:295-300(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Placenta.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6), VARIANT VAL-57.
    Tissue: Placenta.
  3. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
  5. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3-453 (ISOFORM 1), INTERACTION WITH LEP.
    Tissue: Erythroleukemia.

Entry informationi

Entry nameiSIGL6_HUMAN
AccessioniPrimary (citable) accession number: O43699
Secondary accession number(s): A8MV71
, B2RTS8, C9JBE5, F8WA78, O15388, O43700
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: November 25, 2008
Last modified: May 11, 2016
This is version 143 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.