O43679 (LDB2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LIM domain-binding protein 2 Short name=LDB-2 Alternative name(s): Carboxyl-terminal LIM domain-binding protein 1 Short name=CLIM-1 LIM domain-binding factor CLIM1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 373 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. |
| Subunit structure | Interacts with LHX9 By similarity. |
| Subcellular location | |
| Post-translational modification | Ubiquitinated by RLIM/RNF12, leading to its degradation by the proteasome By similarity. |
| Sequence similarities | Belongs to the LDB family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43679-1) Also known as: a; CLIM1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43679-2) Also known as: b; CLIM1b; The sequence of this isoform differs from the canonical sequence as follows: 298-331: DVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA → GLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH 332-373: Missing. | ||||||
| Note: Lacks LIM-binding domain. | ||||||
| Isoform 3 (identifier: O43679-3) The sequence of this isoform differs from the canonical sequence as follows: 1-24: Missing. 296-297: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 373 | 373 | LIM domain-binding protein 2 | PRO_0000084387 | |||||
Regions | |||||||||
| Region | 298 – 336 | 39 | LIM-binding domain (LID) By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 24 | 24 | Missing in isoform 3. | VSP_027825 | |||||
| Alternative sequence | 296 – 297 | 2 | Missing in isoform 3. | VSP_027828 | |||||
| Alternative sequence | 298 – 331 | 34 | DVMVV…QYDAA → GLGAIPNCSLNPGRDGDLCH STAVTPSGQFKEKH in isoform 2. | VSP_027826 | |||||
| Alternative sequence | 332 – 373 | 42 | Missing in isoform 2. | VSP_027827 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and chromosomal localization of two novel human genes encoding LIM-domain binding factors CLIM1 and CLIM2/LDB1/NLI." Semina E.V., Altherr M.R., Murray J.C. Mamm. Genome 9:921-924(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Cloning and identification of LDB1 cDNA." Zhou Y., Du G.W., Wang J.H., Yuan J.G., Qiang B.Q. Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [3] | "Cloning, characterization, and physical mapping of the human homologs of the mouse C-LIM gene." Phillips J.C., Goldman D.A., Wiggs J.L. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [4] | "Selection system for genes encoding nuclear-targeted proteins." Ueki N., Oda T., Kondo M., Yano K., Noguchi T., Muramatsu M.-A. Nat. Biotechnol. 16:1338-1342(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), SUBCELLULAR LOCATION. Tissue: Fetal brain. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [6] | "Spliced isoforms of LIM-domain-binding protein (CLIM/NLI/Ldb) lacking the LIM-interaction domain." Tran Y.H., Xu Z., Kato A., Mistry A.C., Goya Y., Taira M., Brandt S.J., Hirose S. J. Biochem. 140:105-119(2006) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [7] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF068651 mRNA. Translation: AAC77817.1. AF052389 mRNA. Translation: AAC13274.1. AF064492 mRNA. Translation: AAC28342.1. AF064493 mRNA. Translation: AAC28343.1. AF047337 mRNA. Translation: AAC83552.1. BC034019 mRNA. Translation: AAH34019.1. |
| IPI | IPI00014634. IPI00790687. IPI00855748. |
| RefSeq | NP_001124306.1. NM_001130834.1. NP_001281.1. NM_001290.3. |
| UniGene | Hs.714330. |
3D structure databases | |
| ProteinModelPortal | O43679. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-24262N. |
| IntAct | O43679. 1 interaction. |
| MINT | MINT-233497. |
| STRING | 9606.ENSP00000306772. |
PTM databases | |
| PhosphoSite | O43679. |
Proteomic databases | |
| PaxDb | O43679. |
| PRIDE | O43679. |
Protocols and materials databases | |
| DNASU | 9079. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000304523; ENSP00000306772; ENSG00000169744. ENST00000441778; ENSP00000392089; ENSG00000169744. |
| GeneID | 9079. |
| KEGG | hsa:9079. |
| UCSC | uc003goz.3. human. uc003gpa.3. human. uc003gpb.3. human. |
Organism-specific databases | |
| CTD | 9079. |
| GeneCards | GC04M016445. |
| HGNC | HGNC:6533. LDB2. |
| HPA | CAB017544. |
| MIM | 603450. gene. |
| neXtProt | NX_O43679. |
| PharmGKB | PA30317. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG282114. |
| HOGENOM | HOG000030908. |
| HOVERGEN | HBG000135. |
| InParanoid | O43679. |
| OMA | LGNSSPW. |
| OrthoDB | EOG4XWFXV. |
| PhylomeDB | O43679. |
Gene expression databases | |
| ArrayExpress | O43679. |
| Bgee | O43679. |
| CleanEx | HS_LDB2. |
| Genevestigator | O43679. |
| GermOnline | ENSG00000169744. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002691. LIM-dom-bd. [Graphical view] |
| PANTHER | PTHR10378. PTHR10378. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | LDB2. human. |
| GenomeRNAi | 9079. |
| NextBio | 34017. |
| SOURCE | Search... |
Entry information
| Entry name | LDB2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43679 Secondary accession number(s): O60619, O75480 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
