O43586 (PPIP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Proline-serine-threonine phosphatase-interacting protein 1 Short name=PEST phosphatase-interacting protein 1 Alternative name(s): CD2-binding protein 1 H-PIP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 416 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in regulation of the actin cytoskeleton. May regulate the WAS actin-bundling activity. Bridges the interaction between ABL1 and PTPN18 leading to the ABL1 dephosphorylation. May play a role as a scaffold protein between PTPN12 and WAS and allows PTPN12 to dephosphorylate WAS. Has the potential to physically couple CD2 and CD2AP to WAS. Acts downstream of CD2 and CD2AP to recruit WAS to the T-cell:APC contact site so as to promote the actin polymerization required for synapse induction during T-cell activation By similarity. Down-regulates CD2-stimulated adhesion through the coupling of PTPN12 to CD2. Ref.1 |
| Subunit structure | Interacts with PTPN18, ABL1, CD2AP and WAS By similarity. Interacts with CD2, PTPN12 and MEFV/pyrin. Interacts with FASLG. Ref.1 Ref.6 Ref.7 |
| Subcellular location | Cytoplasm By similarity. Cytoplasm › cytoskeleton By similarity. Cell projection › lamellipodium By similarity. Cytoplasm › perinuclear region By similarity. Cleavage furrow By similarity. Note: Colocalized with the cortical actin cytoskeleton during interphase, lamellipodia and actin-rich cytokinetic cleavage furrow. Colocalized with WAS to filamentous structures within the cytoplasm. Colocalized with PTPN12 in the cytoplasm and the perinuclear region. Colocalized with CD2AP and WAS in the actin cytoskeleton. Colocalized with CD2, CD2AP and WAS at the site of T-cell:APC contact By similarity. Ref.1 |
| Tissue specificity | Highly expressed in the peripheral blood leukocytes, granulocytes and monocytes, namely in T-cells and natural killer cells, and in spleen. Weakly expressed in the thymus, small intestine, lung and placenta. Ref.1 Ref.6 |
| Domain | The coiled domain mediates interaction with PTPN18, PTPN12 and CD2AP. The SH3 domain mediates interaction with WAS and ABL1 By similarity. The SH3 and coiled-coil domains are necessary for the interaction with MEFV. |
| Post-translational modification | Dephosphorylated on Tyr-345 by PTPN18, this event negatively regulates the association of PSTPIP1 with SH2 domain-containing proteins as tyrosine kinase. Phosphorylation of Tyr-345 is probably required for subsequent phosphorylation at other tyrosine residues. Phosphorylation is induced by activation of the EGFR and PDGFR in a ABL1 dependent manner. The phosphorylation regulates the interaction with WAS and with MEFV By similarity. |
| Involvement in disease | PAPA syndrome (PAPAS) [MIM:604416]: Characterized by autosomal dominant inheritance of early-onset, primarily affecting skin and joint tissues. Recurring inflammatory episodes lead to accumulation of sterile, pyogenic, neutrophil-rich material within the affected joints, ultimately resulting in significant destruction. |
| Sequence similarities | Contains 1 FCH domain. Contains 1 SH3 domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43586-1) Also known as: CD2BP1L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43586-2) Also known as: CD2BP1S; The sequence of this isoform differs from the canonical sequence as follows: 280-309: APVPYQNYYDREVTPLTSSPGIQPSCGMIK → GEVRLADSAAS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||
Molecule processing | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 416 | 416 | Proline-serine-threonine phosphatase-interacting protein 1 | PRO_0000058539 | ||||||||||||||||
Regions | ||||||||||||||||||||
| Domain | 5 – 82 | 78 | FCH | |||||||||||||||||
| Domain | 359 – 416 | 58 | SH3 | |||||||||||||||||
| Coiled coil | 166 – 212 | 47 | Potential | |||||||||||||||||
Amino acid modifications | ||||||||||||||||||||
| Modified residue | 345 | 1 | Phosphotyrosine By similarity | |||||||||||||||||
Natural variations | ||||||||||||||||||||
| Alternative sequence | 280 – 309 | 30 | APVPY…CGMIK → GEVRLADSAAS in isoform 2. | VSP_015627 | ||||||||||||||||
| Natural variant | 48 | 1 | Q → H. Ref.2 Corresponds to variant rs1141038 [ dbSNP | Ensembl ]. | VAR_023515 | ||||||||||||||||
| Natural variant | 106 | 1 | E → K. Ref.2 Corresponds to variant rs1141039 [ dbSNP | Ensembl ]. | VAR_023516 | ||||||||||||||||
| Natural variant | 146 | 1 | Q → H. Ref.2 Corresponds to variant rs1141041 [ dbSNP | Ensembl ]. | VAR_023517 | ||||||||||||||||
| Natural variant | 149 | 1 | R → L. Ref.2 Corresponds to variant rs1141042 [ dbSNP | Ensembl ]. | VAR_023518 | ||||||||||||||||
| Natural variant | 151 | 1 | A → S. Ref.2 Corresponds to variant rs1141043 [ dbSNP | Ensembl ]. | VAR_023519 | ||||||||||||||||
| Natural variant | 155 | 1 | E → D. Ref.2 Corresponds to variant rs1141044 [ dbSNP | Ensembl ]. | VAR_023520 | ||||||||||||||||
| Natural variant | 156 | 1 | Q → H. Ref.2 Corresponds to variant rs1141045 [ dbSNP | Ensembl ]. | VAR_023521 | ||||||||||||||||
| Natural variant | 230 | 1 | A → T in PAPAS; severely reduced binding with PTPN12; markedly increased binding to MEFV; accentuates the IL1B secretion. Ref.6 Ref.9 Corresponds to variant rs28939381 [ dbSNP | Ensembl ]. | VAR_023522 | ||||||||||||||||
| Natural variant | 250 | 1 | E → Q in PAPAS; severely reduced binding with PTPN12; markedly increased binding to MEFV; accentuates the IL1B secretion. Ref.6 Ref.9 Corresponds to variant rs28939089 [ dbSNP | Ensembl ]. | VAR_023523 | ||||||||||||||||
Experimental info | ||||||||||||||||||||
| Mutagenesis | 232 | 1 | W → A: Abolishes binding to MEFV. Ref.6 | |||||||||||||||||
| Mutagenesis | 345 | 1 | Y → F: Decreases binding to MEFV. Ref.6 | |||||||||||||||||
| Sequence conflict | 367 | 1 | L → F in AAD00762. Ref.2 | |||||||||||||||||
Secondary structure | ||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||
| Beta strand | 363 – 365 | 3 | ||||||||||||||||||
| Beta strand | 373 – 377 | 5 | ||||||||||||||||||
| Beta strand | 385 – 390 | 6 | ||||||||||||||||||
| Beta strand | 393 – 401 | 9 | ||||||||||||||||||
| Beta strand | 404 – 409 | 6 | ||||||||||||||||||
| Helix | 410 – 412 | 3 | ||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A cdc15-like adaptor protein (CD2BP1) interacts with the CD2 cytoplasmic domain and regulates CD2-triggered adhesion." Li J., Nishizawa K., An W., Hussey R.E., Lialios F.E., Salgia R., Sunder-Plassmann R., Reinherz E.L. EMBO J. 17:7320-7336(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, INTERACTION WITH CD2 AND PTPN12, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "The human homologue of mouse PTP-PIP interactor protein." Wilson L.A., Fields D., Cruz L., Lasky L., Friesen J., Siminovitch K.A. Submitted (MAR-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS HIS-48; LYS-106; HIS-146; LEU-149; SER-151; ASP-155 AND HIS-156. |
| [3] | "Human protein factory for converting the transcriptome into an in vitro-expressed proteome." Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. Nomura N.Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [6] | "Pyrin binds the PSTPIP1/CD2BP1 protein, defining familial Mediterranean fever and PAPA syndrome as disorders in the same pathway." Shoham N.G., Centola M., Mansfield E., Hull K.M., Wood G., Wise C.A., Kastner D.L. Proc. Natl. Acad. Sci. U.S.A. 100:13501-13506(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MEFV, TISSUE SPECIFICITY, CHARACTERIZATION OF VARIANTS PAPAS THR-230 AND GLN-250, MUTAGENESIS OF TRP-232 AND TYR-345. |
| [7] | "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening." Voss M., Lettau M., Janssen O. BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FASLG. |
| [8] | "Solution structure of the SH3 domain of the human proline-serine-threonine phosphatase-interacting protein 1." RIKEN structural genomics initiative (RSGI) Submitted (FEB-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 358-416. |
| [9] | "Mutations in CD2BP1 disrupt binding to PTP PEST and are responsible for PAPA syndrome, an autoinflammatory disorder." Wise C.A., Gillum J.D., Seidman C.E., Lindor N.M., Veile R., Bashiardes S., Lovett M. Hum. Mol. Genet. 11:961-969(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PAPAS THR-230 AND GLN-250, CHARACTERIZATION OF VARIANTS PAPAS THR-230 AND GLN-250. |
| + | Additional computationally mapped references. |
Web resources
| INFEVERS Repertory of FMF and hereditary autoinflammatory disorders mutations |
| GeneReviews |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF038602 mRNA. Translation: AAD11958.1. AF038603 mRNA. Translation: AAD11959.1. U94778 mRNA. Translation: AAD00762.1. AB451310 mRNA. Translation: BAG70124.1. AB451440 mRNA. Translation: BAG70254.1. CH471136 Genomic DNA. Translation: EAW99213.1. BC008602 mRNA. Translation: AAH08602.1. | ||||||||||||
| IPI | IPI00022606. IPI00643697. | ||||||||||||
| RefSeq | NP_003969.2. NM_003978.3. | ||||||||||||
| UniGene | Hs.129758. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O43586. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O43586. 1 interaction. | ||||||||||||
| MINT | MINT-1130527. | ||||||||||||
| STRING | 9606.ENSP00000368914. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O43586. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O43586. | ||||||||||||
| PRIDE | O43586. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 9051. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000558012; ENSP00000452746; ENSG00000140368. ENST00000559295; ENSP00000452743; ENSG00000140368. | ||||||||||||
| GeneID | 9051. | ||||||||||||
| KEGG | hsa:9051. | ||||||||||||
| UCSC | uc002bcf.2. human. uc010bkw.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 9051. | ||||||||||||
| GeneCards | GC15P077287. | ||||||||||||
| HGNC | HGNC:9580. PSTPIP1. | ||||||||||||
| HPA | HPA010600. | ||||||||||||
| MIM | 604416. phenotype. 606347. gene. | ||||||||||||
| neXtProt | NX_O43586. | ||||||||||||
| Orphanet | 69126. Pyogenic arthritis - pyoderma gangrenosum - acne. | ||||||||||||
| PharmGKB | PA33931. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG303711. | ||||||||||||
| HOGENOM | HOG000294218. | ||||||||||||
| HOVERGEN | HBG052960. | ||||||||||||
| InParanoid | O43586. | ||||||||||||
| KO | K12804. | ||||||||||||
| OMA | NYYDREV. | ||||||||||||
| OrthoDB | EOG4PZJ6T. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||
| SignaLink | O43586. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O43586. | ||||||||||||
| Bgee | O43586. | ||||||||||||
| CleanEx | HS_PSTPIP1. | ||||||||||||
| Genevestigator | O43586. | ||||||||||||
| GermOnline | ENSG00000140368. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001060. FCH_dom. IPR011254. Prismane-like. IPR001452. SH3_domain. IPR013315. Spectrin_alpha_SH3. [Graphical view] | ||||||||||||
| Pfam | PF00611. FCH. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00452. SH3DOMAIN. PR01887. SPECTRNALPHA. | ||||||||||||
| SMART | SM00055. FCH. 1 hit. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF56821. Prismane_like. 1 hit. SSF50044. SH3. 1 hit. | ||||||||||||
| PROSITE | PS50133. FCH. 1 hit. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | O43586. | ||||||||||||
| GenomeRNAi | 9051. | ||||||||||||
| NextBio | 33911. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PPIP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43586 Secondary accession number(s): B5BU74 O95657 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
