O43521 (B2L11_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 124.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bcl-2-like protein 11 Short name=Bcl2-L-11 Alternative name(s): Bcl2-interacting mediator of cell death | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 198 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.11 |
| Subunit structure | Forms heterodimers with a number of antiapoptotic Bcl-2 proteins including MCL1, BCL2, BCL2L1 isoform Bcl-X(L), BCL2A1/BFL-1, BHRF1, and BCLW. Isoform BimS and isoform Bim-alpha3 interact with BAX; this interaction induces the conformationally active form of BAX. Does not heterodimerize with proapoptotic proteins such as BAD, BOK or BAK By similarity. Interacts with DYNLL1 and YWHAZ By similarity. When phosphorylated, interacts with TRIM2; this interaction is associated with ubiquitination and degradation By similarity. Ref.4 Ref.14 |
| Subcellular location | Endomembrane system; Peripheral membrane protein By similarity. Note: Associated with intracytoplasmic membranes By similarity. Ref.2 Ref.3 Ref.11 Isoform BimEL: Mitochondrion Ref.2 Ref.3 Ref.11. Note: Translocates from microtubules to motochondria on loss of cell adherence. Ref.2 Ref.3 Ref.11 Isoform BimL: Mitochondrion Ref.2 Ref.3 Ref.11. Isoform BimS: Mitochondrion Ref.2 Ref.3 Ref.11. Isoform Bim-alpha1: Mitochondrion Ref.2 Ref.3 Ref.11. |
| Tissue specificity | Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are ubiquitously expressed with a tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney. Ref.3 |
| Induction | By ER stress in a DDIT3/CHOP-dependent manner. Ref.15 |
| Domain | The BH3 motif is required for Bcl-2 binding and cytotoxicity. |
| Post-translational modification | Phosphorylation at Ser-69 by MAPK1/MAPK3 induces interaction with TRIM2, followed by polyubiquitination. Ubiquitinated by TRIM2 following phosphorylation by MAPK1/MAPK3, leading to degradation by the proteasome By similarity. Ref.11 |
| Sequence similarities | Belongs to the Bcl-2 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BAX | Q07812 | 11 | EBI-526406,EBI-516580 | |
| BCL2 | P10415 | 4 | EBI-526406,EBI-77694 | |
| Bcl2a1 | Q07440 | 2 | EBI-526406,EBI-707754 | From a different organism. |
| BCL2L1 | Q07817-1 | 10 | EBI-526406,EBI-287195 | |
| BCL2L2 | Q92843 | 4 | EBI-526406,EBI-707714 | |
| GNB2L1 | P63244 | 2 | EBI-526406,EBI-296739 | |
| MCL1 | Q07820 | 8 | EBI-526406,EBI-1003422 | |
| Mcl1 | P97287 | 5 | EBI-526406,EBI-707292 | From a different organism. |
| MIF | P14174 | 5 | EBI-526420,EBI-372712 |
Alternative products
| This entry describes 20 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform BimEL (identifier: O43521-1) Also known as: Bim(EL); This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform BimL (identifier: O43521-2) Also known as: Bim(L); The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. | ||||||
| Isoform BimS (identifier: O43521-3) Also known as: BCL2-like 11 transcript variant 9; Bim(S); The sequence of this isoform differs from the canonical sequence as follows: 42-131: Missing. | ||||||
| Isoform Bim-alpha1 (identifier: O43521-4) Also known as: BimABCD; Bim-ABCD; The sequence of this isoform differs from the canonical sequence as follows: 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK | ||||||
| Isoform Bim-alpha2 (identifier: O43521-5) Also known as: BimACD; Bim-ACD; The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK | ||||||
| Isoform Bim-alpha3 (identifier: O43521-6) Also known as: BCL2-like 11 transcript variant 10; BimAD; Bim-AD; The sequence of this isoform differs from the canonical sequence as follows: 42-131: Missing. 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK | ||||||
| Isoform Bim-alpha4 (identifier: O43521-7) The sequence of this isoform differs from the canonical sequence as follows: 42-131: Missing. 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LAKLLASST | ||||||
| Isoform Bim-alpha5 (identifier: O43521-8) The sequence of this isoform differs from the canonical sequence as follows: 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD | ||||||
| Isoform Bim-alpha6 (identifier: O43521-9) The sequence of this isoform differs from the canonical sequence as follows: 42-131: Missing. 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD | ||||||
| Isoform Bim-beta1 (identifier: O43521-10) The sequence of this isoform differs from the canonical sequence as follows: 133-135: SMR → NWD 136-198: Missing. | ||||||
| Isoform Bim-beta2 (identifier: O43521-11) The sequence of this isoform differs from the canonical sequence as follows: 132-135: ASMR → GIFE 136-198: Missing. | ||||||
| Isoform Bim-beta3 (identifier: O43521-12) The sequence of this isoform differs from the canonical sequence as follows: 42-75: GNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFAT → VSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK | ||||||
| Isoform Bim-beta4 (identifier: O43521-13) The sequence of this isoform differs from the canonical sequence as follows: 43-44: NP → IF 45-198: Missing. | ||||||
| Isoform Bim-beta5 (identifier: O43521-14) The sequence of this isoform differs from the canonical sequence as follows: 132-140: ASMRQAEPA → VREIEEVVV 141-198: Missing. | ||||||
| Isoform Bim-beta6 (identifier: O43521-15) The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. 132-135: ASMR → GIFE 136-198: Missing. | ||||||
| Isoform Bim-beta7 (identifier: O43521-16) The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. 132-140: ASMRQAEPA → VREIEEVVV 141-198: Missing. | ||||||
| Isoform Bim-gamma (identifier: O43521-17) The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. 132-198: ASMRQAEPAD...YIVRLVWRMH → VVILEDIGDL...TEQLNHKDFS | ||||||
| Isoform BimABC (identifier: O43521-18) Also known as: Bim-ABC; The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. 132-166: Missing. | ||||||
| Isoform BimAC (identifier: O43521-19) Also known as: Bim-AC; The sequence of this isoform differs from the canonical sequence as follows: 132-166: Missing. | ||||||
| Isoform BimA (identifier: O43521-20) Also known as: Bim-A; The sequence of this isoform differs from the canonical sequence as follows: 42-166: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 198 | 198 | Bcl-2-like protein 11 | PRO_0000143109 | |||||||
Regions | |||||||||||
| Motif | 148 – 162 | 15 | BH3 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 69 | 1 | Phosphoserine; by MAPK Ref.11 | ||||||||
| Modified residue | 87 | 1 | Phosphoserine By similarity | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 42 – 166 | 125 | Missing in isoform BimA. | VSP_042865 | |||||||
| Alternative sequence | 42 – 131 | 90 | Missing in isoform BimS, isoform Bim-alpha3, isoform Bim-alpha6 and isoform Bim-alpha4. | VSP_035608 | |||||||
| Alternative sequence | 42 – 101 | 60 | Missing in isoform BimABC, isoform BimL, isoform Bim-alpha2, isoform Bim-gamma, isoform Bim-beta6 and isoform Bim-beta7. | VSP_000535 | |||||||
| Alternative sequence | 42 – 75 | 34 | GNPEG…GPFAT → VSLCHPGWSALVRSWLTATS NSQVQAVLLPQPPK in isoform Bim-beta3. | VSP_035609 | |||||||
| Alternative sequence | 43 – 44 | 2 | NP → IF in isoform Bim-beta4. | VSP_035610 | |||||||
| Alternative sequence | 45 – 198 | 154 | Missing in isoform Bim-beta4. | VSP_035611 | |||||||
| Alternative sequence | 132 – 198 | 67 | ASMRQ…VWRMH → VVILEDIGDLSLCFGFIFTG LDLYGHHHSQDTEQLNHKDF S in isoform Bim-gamma. | VSP_035612 | |||||||
| Alternative sequence | 132 – 166 | 35 | Missing in isoform BimAC and isoform BimABC. | VSP_042866 | |||||||
| Alternative sequence | 132 – 140 | 9 | ASMRQAEPA → VREIEEVVV in isoform Bim-beta5 and isoform Bim-beta7. | VSP_035613 | |||||||
| Alternative sequence | 132 – 135 | 4 | ASMR → GIFE in isoform Bim-beta2 and isoform Bim-beta6. | VSP_035614 | |||||||
| Alternative sequence | 133 – 135 | 3 | SMR → NWD in isoform Bim-beta1. | VSP_035615 | |||||||
| Alternative sequence | 136 – 198 | 63 | Missing in isoform Bim-beta1, isoform Bim-beta2 and isoform Bim-beta6. | VSP_035616 | |||||||
| Alternative sequence | 141 – 198 | 58 | Missing in isoform Bim-beta5 and isoform Bim-beta7. | VSP_035617 | |||||||
| Alternative sequence | 167 – 198 | 32 | VFLNN…VWRMH → LEK in isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3. | VSP_035620 | |||||||
| Alternative sequence | 167 – 198 | 32 | VFLNN…VWRMH → LAKLLASST in isoform Bim-alpha4. | VSP_035618 | |||||||
| Alternative sequence | 167 – 198 | 32 | VFLNN…VWRMH → MPLPPD in isoform Bim-alpha5 and isoform Bim-alpha6. | VSP_035619 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 156 | 1 | G → A: Retains the ability to induce apoptosis. Abolishes interaction with BAX; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BCL2. Ref.4 Ref.12 | ||||||||
| Mutagenesis | 156 | 1 | G → E: Abolishes induction of apoptosis. Abolishes interaction with BAX and BCL2; in isoform Bim-alpha3 and isoform BimS. Loses the ability to induce the conformationally active form of BAX. Ref.4 Ref.12 | ||||||||
| Mutagenesis | 160 | 1 | N → A: Retains the ability to induce apoptosis. Abolishes interaction with BCL2; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BAX. Ref.4 | ||||||||
| Sequence conflict | 33 | 1 | P → L in BAF83066. Ref.7 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 143 – 159 | 17 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Bim: a novel member of the Bcl-2 family that promotes apoptosis." O'Connor L., Strasser A., O'Reilly L.A., Hausmann G., Adams J.M., Cory S., Huang D.C.S. EMBO J. 17:384-395(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMEL AND BIML), FUNCTION. Tissue: Peripheral blood and Spleen. |
| [2] | "Molecular cloning and characterization of six novel isoforms of human Bim, a member of the proapoptotic Bcl-2 family." Mami U., Miyashita T., Shikama Y., Tadokoro K., Yamada M. FEBS Lett. 509:135-141(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIM-ALPHA1; BIM-ALPHA2; BIM-BETA1; BIM-BETA2; BIM-BETA3 AND BIM-BETA4), FUNCTION (ISOFORMS BIM-ALPHA1 AND BIM-ALPHA2), SUBCELLULAR LOCATION. |
| [3] | "Identification and characterization of Bimgamma, a novel proapoptotic BH3-only splice variant of Bim." Liu J.-W., Chandra D., Tang S.H., Chopra D., Tang D.G. Cancer Res. 62:2976-2981(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BIM-GAMMA), FUNCTION (ISOFORM BIM-GAMMA), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [4] | "Identification of novel isoforms of the BH3 domain protein Bim which directly activate Bax to trigger apoptosis." Marani M., Tenev T., Hancock D., Downward J., Lemoine N.R. Mol. Cell. Biol. 22:3577-3589(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMEL; BIML; BIMS; BIM-ALPHA1; BIM-ALPHA2; BIM-ALPHA3; BIMA; BIMABC AND BIMAC), ALTERNATIVE SPLICING, FUNCTION, SUBUNIT, MUTAGENESIS OF GLY-156 AND ASN-160. Tissue: Embryonic kidney and Ovarian cancer. |
| [5] | "Over-expression of Bim alpha3, a novel isoform of human Bim, result in cell apoptosis." Chen J.Z., Ji C.N., Gu S.H., Li J.X., Zhao E.P., Huang Y., Huang L., Ying K., Xie Y., Mao Y.M. Int. J. Biochem. Cell Biol. 36:1554-1561(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMS AND BIM-ALPHA3), FUNCTION (ISOFORM BIM-ALPHA3). |
| [6] | "Identification and characterization of BH3 domain protein Bim and its isoforms in human hepatocellular carcinomas." Miao J., Chen G.G., Yun J.P., Chun S.Y., Zheng Z.Z., Ho R.L.K., Chak E.C., Xia N.S., Lai P.B. Apoptosis 12:1691-1701(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIM-ALPHA3; BIM-ALPHA4; BIM-ALPHA5; BIM-ALPHA6; BIM-BETA5; BIM-BETA6; BIM-BETA7). |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS BIMEL AND BIML). Tissue: Teratocarcinoma and Tongue. |
| [8] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BIMEL). Tissue: Blood. |
| [11] | "BimEL is an important determinant for induction of anoikis sensitivity by mitogen-activated protein/extracellular signal-regulated kinase kinase inhibitors." Fukazawa H., Noguchi K., Masumi A., Murakami Y., Uehara Y. Mol. Cancer Ther. 3:1281-1288(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-69, UBIQUITINATION. |
| [12] | "Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak." Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Science 315:856-859(2007) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF GLY-156. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [14] | "Identification of a novel Bcl-2-interacting mediator of cell death (Bim) E3 ligase, tripartite motif-containing protein 2 (TRIM2), and its role in rapid ischemic tolerance-induced neuroprotection." Thompson S., Pearson A.N., Ashley M.D., Jessick V., Murphy B.M., Gafken P., Henshall D.C., Morris K.T., Simon R.P., Meller R. J. Biol. Chem. 286:19331-19339(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TRIM2. |
| [15] | "CHOP potentially co-operates with FOXO3a in neuronal cells to regulate PUMA and BIM expression in response to ER stress." Ghosh A.P., Klocke B.J., Ballestas M.E., Roth K.A. PLoS ONE 7:E39586-E39586(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| [16] | "Structural insights into the degradation of Mcl-1 induced by BH3 domains." Czabotar P.E., Lee E.F., van Delft M.F., Day C.L., Smith B.J., Huang D.C.S., Fairlie W.D., Hinds M.G., Colman P.M. Proc. Natl. Acad. Sci. U.S.A. 104:6217-6222(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 141-166 IN COMPLEX WITH MCL1. |
| [17] | "Completing the family portrait of the anti-apoptotic Bcl-2 proteins: crystal structure of human Bfl-1 in complex with Bim." Herman M.D., Nyman T., Welin M., Lehtio L., Flodin S., Tresaugues L., Kotenyova T., Flores A., Nordlund P. FEBS Lett. 582:3590-3594(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 141-165 IN COMPLEX WITH BCL2A1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF032457 mRNA. Translation: AAC39593.1. AF032458 mRNA. Translation: AAC39594.1. AB071195 mRNA. Translation: BAB78589.1. AB071196 mRNA. Translation: BAB78590.1. AB071197 mRNA. Translation: BAB78591.1. AB071198 mRNA. Translation: BAB78592.1. AB071199 mRNA. Translation: BAB78593.1. AB071200 mRNA. Translation: BAB78594.1. AY352518 mRNA. Translation: AAQ62569.1. AY305714 mRNA. Translation: AAQ82546.1. AY305715 mRNA. Translation: AAQ82547.1. AY423441 mRNA. Translation: AAQ99148.1. AY423442 mRNA. Translation: AAQ99149.1. AY423443 mRNA. Translation: AAQ99150.1. AY428962 mRNA. Translation: AAR06908.1. DQ849200 mRNA. Translation: ABI13589.1. DQ849201 mRNA. Translation: ABI13590.1. DQ849202 mRNA. Translation: ABI13591.1. AK290377 mRNA. Translation: BAF83066.1. AK291269 mRNA. Translation: BAF83958.1. AC096670 Genomic DNA. Translation: AAY14797.1. CH471237 Genomic DNA. Translation: EAW50365.1. CH471237 Genomic DNA. Translation: EAW50367.1. CH471237 Genomic DNA. Translation: EAW50369.1. CH471237 Genomic DNA. Translation: EAW50370.1. CH471237 Genomic DNA. Translation: EAW50371.1. CH471237 Genomic DNA. Translation: EAW50372.1. CH471237 Genomic DNA. Translation: EAW50373.1. CH471237 Genomic DNA. Translation: EAW50374.1. BC033694 mRNA. Translation: AAH33694.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00012853. IPI00103743. IPI00216585. IPI00410159. IPI00428840. IPI00451139. IPI00514401. IPI00873921. IPI00878323. IPI00914559. IPI00914560. IPI00914563. IPI00914586. IPI00914592. IPI00914600. IPI00914670. IPI00914677. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001191035.1. NM_001204106.1. NP_001191036.1. NM_001204107.1. NP_001191037.1. NM_001204108.1. NP_001191038.1. NM_001204109.1. NP_001191039.1. NM_001204110.1. NP_001191040.1. NM_001204111.1. NP_001191041.1. NM_001204112.1. NP_001191042.1. NM_001204113.1. NP_006529.1. NM_006538.4. NP_619527.1. NM_138621.4. NP_619528.1. NM_138622.3. NP_619529.1. NM_138623.3. NP_619530.1. NM_138624.3. NP_619531.1. NM_138625.3. NP_619532.1. NM_138626.3. NP_619533.1. NM_138627.3. NP_996885.1. NM_207002.3. NP_996886.1. NM_207003.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.469658. Hs.737004. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-29185N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | O43521. 20 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1664421. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 10018. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000308659; ENSP00000309226; ENSG00000153094. ENST00000337565; ENSP00000338374; ENSG00000153094. ENST00000357757; ENSP00000350398; ENSG00000153094. ENST00000361493; ENSP00000354879; ENSG00000153094. ENST00000393253; ENSP00000376942; ENSG00000153094. ENST00000393256; ENSP00000376943; ENSG00000153094. ENST00000405953; ENSP00000384641; ENSG00000153094. ENST00000415458; ENSP00000393781; ENSG00000153094. ENST00000431217; ENSP00000394640; ENSG00000153094. ENST00000433098; ENSP00000401662; ENSG00000153094. ENST00000436733; ENSP00000403727; ENSG00000153094. ENST00000437029; ENSP00000412892; ENSG00000153094. ENST00000439718; ENSP00000411137; ENSG00000153094. ENST00000452231; ENSP00000391292; ENSG00000153094. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 10018. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:10018. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002tgt.1. human. uc002tgu.1. human. uc002tgv.1. human. uc002tgw.2. human. uc002tgx.2. human. uc002tgy.2. human. uc002tgz.2. human. uc002tha.2. human. uc002thb.2. human. uc002thc.2. human. uc002thd.2. human. uc010fkd.2. human. uc021vmp.1. human. uc021vmq.1. human. uc021vmr.1. human. uc021vms.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 10018. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC02P111876. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:994. BCL2L11. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB026332. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 603827. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA25305. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG40262. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K16341. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | IRLVWRM. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4C87TR. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | foxopathway. FoxO family signaling. p75ntrpathway. p75(NTR)-mediated signaling. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_578. Apoptosis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000153094. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR014771. Apoptosis_Bim_N. IPR017288. Bcl-2-like_11. IPR015040. Bcl-x_interacting. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF08945. Bclx_interact. 1 hit. PF06773. Bim_N. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF037827. Bcl-2-like_p11. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS01259. BH3. False negative. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL5777. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | BCL2L11. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 10018. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 37849. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | O43521. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | B2L11_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43521 Secondary accession number(s): A8K2W2 Q8WYM1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
