Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O43521

- B2L11_HUMAN

UniProt

O43521 - B2L11_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Bcl-2-like protein 11

Gene

BCL2L11

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.3 Publications

GO - Biological processi

  1. activation of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
  2. apoptotic process Source: UniProtKB
  3. apoptotic process involved in embryonic digit morphogenesis Source: Ensembl
  4. apoptotic signaling pathway Source: Reactome
  5. B cell apoptotic process Source: Ensembl
  6. B cell homeostasis Source: Ensembl
  7. brain development Source: Ensembl
  8. cell-matrix adhesion Source: Ensembl
  9. cellular process regulating host cell cycle in response to virus Source: Ensembl
  10. developmental pigmentation Source: Ensembl
  11. ear development Source: Ensembl
  12. extrinsic apoptotic signaling pathway in absence of ligand Source: Ensembl
  13. intrinsic apoptotic signaling pathway Source: Reactome
  14. intrinsic apoptotic signaling pathway in response to DNA damage Source: MGI
  15. in utero embryonic development Source: Ensembl
  16. kidney development Source: Ensembl
  17. male gonad development Source: Ensembl
  18. mammary gland development Source: Ensembl
  19. myeloid cell homeostasis Source: Ensembl
  20. neurotrophin TRK receptor signaling pathway Source: Reactome
  21. odontogenesis of dentin-containing tooth Source: Ensembl
  22. positive regulation of apoptotic process Source: UniProtKB
  23. positive regulation of apoptotic process by virus Source: Ensembl
  24. positive regulation of cell cycle Source: Ensembl
  25. positive regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: Ensembl
  26. positive regulation of fibroblast apoptotic process Source: UniProtKB
  27. positive regulation of intrinsic apoptotic signaling pathway Source: UniProtKB
  28. positive regulation of mitochondrial membrane permeability involved in apoptotic process Source: Ensembl
  29. positive regulation of neuron apoptotic process Source: Ensembl
  30. positive regulation of protein homooligomerization Source: BHF-UCL
  31. positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway Source: Reactome
  32. positive regulation of release of cytochrome c from mitochondria Source: UniProtKB
  33. post-embryonic organ morphogenesis Source: Ensembl
  34. regulation of developmental pigmentation Source: Ensembl
  35. regulation of organ growth Source: Ensembl
  36. response to endoplasmic reticulum stress Source: UniProtKB
  37. spermatogenesis Source: Ensembl
  38. spleen development Source: Ensembl
  39. T cell homeostasis Source: Ensembl
  40. thymocyte apoptotic process Source: Ensembl
  41. thymus development Source: Ensembl
  42. tube formation Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

ReactomeiREACT_13638. NRAGE signals death through JNK.
REACT_330. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2-like protein 11
Short name:
Bcl2-L-11
Alternative name(s):
Bcl2-interacting mediator of cell death
Gene namesi
Name:BCL2L11
Synonyms:BIM
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:994. BCL2L11.

Subcellular locationi

Endomembrane system By similarity; Peripheral membrane protein By similarity
Note: Associated with intracytoplasmic membranes.By similarity
Isoform BimEL : Mitochondrion
Note: Translocates from microtubules to motochondria on loss of cell adherence.

GO - Cellular componenti

  1. BIM-BCL-2 complex Source: UniProtKB
  2. BIM-BCL-xl complex Source: UniProtKB
  3. cytosol Source: UniProtKB
  4. extrinsic component of membrane Source: Ensembl
  5. mitochondrial outer membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi156 – 1561G → A: Retains the ability to induce apoptosis. Abolishes interaction with BAX; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BCL2. 2 Publications
Mutagenesisi156 – 1561G → E: Abolishes induction of apoptosis. Abolishes interaction with BAX and BCL2; in isoform Bim-alpha3 and isoform BimS. Loses the ability to induce the conformationally active form of BAX. 2 Publications
Mutagenesisi160 – 1601N → A: Retains the ability to induce apoptosis. Abolishes interaction with BCL2; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BAX. 1 Publication

Organism-specific databases

PharmGKBiPA25305.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 198198Bcl-2-like protein 11PRO_0000143109Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei69 – 691Phosphoserine; by MAPK1 Publication

Post-translational modificationi

Phosphorylation at Ser-69 by MAPK1/MAPK3 induces interaction with TRIM2, followed by polyubiquitination.1 Publication
Ubiquitinated by TRIM2 following phosphorylation by MAPK1/MAPK3, leading to degradation by the proteasome.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiO43521.
PaxDbiO43521.
PRIDEiO43521.

PTM databases

PhosphoSiteiO43521.

Miscellaneous databases

PMAP-CutDBO43521.

Expressioni

Tissue specificityi

Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are ubiquitously expressed with a tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney.1 Publication

Inductioni

By ER stress in a DDIT3/CHOP-dependent manner.1 Publication

Gene expression databases

BgeeiO43521.
ExpressionAtlasiO43521. baseline and differential.
GenevestigatoriO43521.

Organism-specific databases

HPAiCAB026332.

Interactioni

Subunit structurei

Forms heterodimers with a number of antiapoptotic Bcl-2 proteins including MCL1, BCL2, BCL2L1 isoform Bcl-X(L), BCL2A1/BFL-1, BHRF1, and BCLW. Isoform BimS and isoform Bim-alpha3 interact with BAX; this interaction induces the conformationally active form of BAX. Does not heterodimerize with proapoptotic proteins such as BAD, BOK or BAK. Interacts with DYNLL1 and YWHAZ. When phosphorylated, interacts with TRIM2; this interaction is associated with ubiquitination and degradation. Interacts with MCL1; may sequester BCL2L11 to prevent its pro-apoptotic activity.4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BADQ929342EBI-526406,EBI-700771
BAXQ0781219EBI-526406,EBI-516580
BCL2P104157EBI-526406,EBI-77694
Bcl2a1Q074402EBI-526406,EBI-707754From a different organism.
BCL2L1Q078172EBI-526406,EBI-78035
BCL2L1Q07817-110EBI-526406,EBI-287195
BCL2L2Q928434EBI-526406,EBI-707714
F1LP684514EBI-526406,EBI-7066119From a different organism.
GNB2L1P632442EBI-526406,EBI-296739
MCL1Q0782011EBI-526406,EBI-1003422
Mcl1P972877EBI-526406,EBI-707292From a different organism.
MIFP141745EBI-526420,EBI-372712
NSP034952EBI-526406,EBI-2548993From a different organism.

Protein-protein interaction databases

BioGridi115335. 44 interactions.
DIPiDIP-29185N.
IntActiO43521. 28 interactions.
MINTiMINT-1664421.

Structurei

Secondary structure

1
198
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi112 – 1154Combined sources
Helixi143 – 15917Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1F95NMR-C/D108-116[»]
2K7WNMR-B145-164[»]
2NL9X-ray1.55B141-166[»]
2V6QX-ray2.70B141-166[»]
2VM6X-ray2.20B141-165[»]
2WH6X-ray1.50B141-166[»]
2YQ6X-ray1.80B147-164[»]
3D7VX-ray2.03B141-166[»]
3FDLX-ray1.78B141-166[»]
3IO8X-ray2.30B/D141-166[»]
3IO9X-ray2.40B141-166[»]
3KJ0X-ray1.70B143-165[»]
3KJ1X-ray1.94B143-163[»]
3KJ2X-ray2.35B143-163[»]
4B4SX-ray1.90B141-166[»]
4D2MX-ray2.10B/D141-166[»]
DisProtiDP00643.
ProteinModelPortaliO43521.
SMRiO43521. Positions 141-173.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO43521.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi148 – 16215BH3Add
BLAST

Domaini

The BH3 motif is required for Bcl-2 binding and cytotoxicity.

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

eggNOGiNOG40262.
GeneTreeiENSGT00390000003178.
InParanoidiO43521.
KOiK16341.
OMAiEMPITSH.
PhylomeDBiO43521.
TreeFamiTF335898.

Family and domain databases

InterProiIPR014771. Apoptosis_Bim_N.
IPR017288. Bcl-2-like_11.
IPR015040. Bcl-x_interacting_BH3_dom.
[Graphical view]
PfamiPF08945. Bclx_interact. 1 hit.
PF06773. Bim_N. 1 hit.
[Graphical view]
PIRSFiPIRSF037827. Bcl-2-like_p11. 1 hit.

Sequences (20)i

Sequence statusi: Complete.

This entry describes 20 isoformsi produced by alternative splicing. Align

Isoform BimEL (identifier: O43521-1) [UniParc]FASTAAdd to Basket

Also known as: Bim(EL)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKQPSDVSS ECDREGRQLQ PAERPPQLRP GAPTSLQTEP QGNPEGNHGG
60 70 80 90 100
EGDSCPHGSP QGPLAPPASP GPFATRSPLF IFMRRSSLLS RSSSGYFSFD
110 120 130 140 150
TDRSPAPMSC DKSTQTPSPP CQAFNHYLSA MASMRQAEPA DMRPEIWIAQ
160 170 180 190
ELRRIGDEFN AYYARRVFLN NYQAAEDHPR MVILRLLRYI VRLVWRMH
Length:198
Mass (Da):22,171
Last modified:June 1, 1998 - v1
Checksum:iD75735E469CA6997
GO
Isoform BimL (identifier: O43521-2) [UniParc]FASTAAdd to Basket

Also known as: Bim(L)

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.

Show »
Length:138
Mass (Da):15,967
Checksum:i8BB4AAE06CB080FA
GO
Isoform BimS (identifier: O43521-3) [UniParc]FASTAAdd to Basket

Also known as: BCL2-like 11 transcript variant 9, Bim(S)

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.

Show »
Length:108
Mass (Da):12,717
Checksum:i60067208524D5BEA
GO
Isoform Bim-alpha1 (identifier: O43521-4) [UniParc]FASTAAdd to Basket

Also known as: BimABCD, Bim-ABCD

The sequence of this isoform differs from the canonical sequence as follows:
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

Show »
Length:169
Mass (Da):18,536
Checksum:iE2E24D5697C955BA
GO
Isoform Bim-alpha2 (identifier: O43521-5) [UniParc]FASTAAdd to Basket

Also known as: BimACD, Bim-ACD

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

Show »
Length:109
Mass (Da):12,332
Checksum:i4335FA21C13B49AD
GO
Isoform Bim-alpha3 (identifier: O43521-6) [UniParc]FASTAAdd to Basket

Also known as: BCL2-like 11 transcript variant 10, BimAD, Bim-AD

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

Show »
Length:79
Mass (Da):9,081
Checksum:i3E03CCF2154A242C
GO
Isoform Bim-alpha4 (identifier: O43521-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LAKLLASST

Show »
Length:85
Mass (Da):9,596
Checksum:i7A6FD9AF07DA3E05
GO
Isoform Bim-alpha5 (identifier: O43521-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD

Show »
Length:172
Mass (Da):18,816
Checksum:iD2F7FC06EE3CE697
GO
Isoform Bim-alpha6 (identifier: O43521-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD

Show »
Length:82
Mass (Da):9,362
Checksum:i08678A7A0FBD4215
GO
Isoform Bim-beta1 (identifier: O43521-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-135: SMR → NWD
     136-198: Missing.

Show »
Length:135
Mass (Da):14,458
Checksum:iD208F1CB6D324539
GO
Isoform Bim-beta2 (identifier: O43521-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-135: ASMR → GIFE
     136-198: Missing.

Show »
Length:135
Mass (Da):14,418
Checksum:iD3A245DECD324539
GO
Isoform Bim-beta3 (identifier: O43521-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-75: GNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFAT → VSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK

Show »
Length:198
Mass (Da):22,649
Checksum:iA8FA866EBD5CF16E
GO
Isoform Bim-beta4 (identifier: O43521-13) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-44: NP → IF
     45-198: Missing.

Show »
Length:44
Mass (Da):4,834
Checksum:iFA9541901CA32FD1
GO
Isoform Bim-beta5 (identifier: O43521-14) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-140: ASMRQAEPA → VREIEEVVV
     141-198: Missing.

Show »
Length:140
Mass (Da):15,025
Checksum:iB7590CC04A98E081
GO
Isoform Bim-beta6 (identifier: O43521-15) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-135: ASMR → GIFE
     136-198: Missing.

Show »
Length:75
Mass (Da):8,214
Checksum:i7CFE6B5A5ED671F3
GO
Isoform Bim-beta7 (identifier: O43521-16) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-140: ASMRQAEPA → VREIEEVVV
     141-198: Missing.

Show »
Length:80
Mass (Da):8,821
Checksum:i6958582B30D7BCAF
GO
Isoform Bim-gamma (identifier: O43521-17) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-198: ASMRQAEPAD...YIVRLVWRMH → VVILEDIGDL...TEQLNHKDFS

Show »
Length:112
Mass (Da):12,412
Checksum:i15E21254C12C239B
GO
Isoform BimABC (identifier: O43521-18) [UniParc]FASTAAdd to Basket

Also known as: Bim-ABC

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-166: Missing.

Show »
Length:103
Mass (Da):11,773
Checksum:iFD4F4A9292591961
GO
Isoform BimAC (identifier: O43521-19) [UniParc]FASTAAdd to Basket

Also known as: Bim-AC

The sequence of this isoform differs from the canonical sequence as follows:
     132-166: Missing.

Show »
Length:163
Mass (Da):17,977
Checksum:i215890B3975C25A5
GO
Isoform BimA (identifier: O43521-20) [UniParc]FASTAAdd to Basket

Also known as: Bim-A

The sequence of this isoform differs from the canonical sequence as follows:
     42-166: Missing.

Show »
Length:73
Mass (Da):8,523
Checksum:iD0CE170469B8570D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti33 – 331P → L in BAF83066. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei42 – 166125Missing in isoform BimA. 1 PublicationVSP_042865Add
BLAST
Alternative sequencei42 – 13190Missing in isoform BimS, isoform Bim-alpha3, isoform Bim-alpha6 and isoform Bim-alpha4. 3 PublicationsVSP_035608Add
BLAST
Alternative sequencei42 – 10160Missing in isoform BimABC, isoform BimL, isoform Bim-alpha2, isoform Bim-gamma, isoform Bim-beta6 and isoform Bim-beta7. 6 PublicationsVSP_000535Add
BLAST
Alternative sequencei42 – 7534GNPEG…GPFAT → VSLCHPGWSALVRSWLTATS NSQVQAVLLPQPPK in isoform Bim-beta3. 1 PublicationVSP_035609Add
BLAST
Alternative sequencei43 – 442NP → IF in isoform Bim-beta4. 1 PublicationVSP_035610
Alternative sequencei45 – 198154Missing in isoform Bim-beta4. 1 PublicationVSP_035611Add
BLAST
Alternative sequencei132 – 19867ASMRQ…VWRMH → VVILEDIGDLSLCFGFIFTG LDLYGHHHSQDTEQLNHKDF S in isoform Bim-gamma. 1 PublicationVSP_035612Add
BLAST
Alternative sequencei132 – 16635Missing in isoform BimAC and isoform BimABC. 1 PublicationVSP_042866Add
BLAST
Alternative sequencei132 – 1409ASMRQAEPA → VREIEEVVV in isoform Bim-beta5 and isoform Bim-beta7. 1 PublicationVSP_035613
Alternative sequencei132 – 1354ASMR → GIFE in isoform Bim-beta2 and isoform Bim-beta6. 2 PublicationsVSP_035614
Alternative sequencei133 – 1353SMR → NWD in isoform Bim-beta1. 1 PublicationVSP_035615
Alternative sequencei136 – 19863Missing in isoform Bim-beta1, isoform Bim-beta2 and isoform Bim-beta6. 2 PublicationsVSP_035616Add
BLAST
Alternative sequencei141 – 19858Missing in isoform Bim-beta5 and isoform Bim-beta7. 1 PublicationVSP_035617Add
BLAST
Alternative sequencei167 – 19832VFLNN…VWRMH → LEK in isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3. 4 PublicationsVSP_035620Add
BLAST
Alternative sequencei167 – 19832VFLNN…VWRMH → LAKLLASST in isoform Bim-alpha4. 1 PublicationVSP_035618Add
BLAST
Alternative sequencei167 – 19832VFLNN…VWRMH → MPLPPD in isoform Bim-alpha5 and isoform Bim-alpha6. 1 PublicationVSP_035619Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF032457 mRNA. Translation: AAC39593.1.
AF032458 mRNA. Translation: AAC39594.1.
AB071195 mRNA. Translation: BAB78589.1.
AB071196 mRNA. Translation: BAB78590.1.
AB071197 mRNA. Translation: BAB78591.1.
AB071198 mRNA. Translation: BAB78592.1.
AB071199 mRNA. Translation: BAB78593.1.
AB071200 mRNA. Translation: BAB78594.1.
AY352518 mRNA. Translation: AAQ62569.1.
AY305714 mRNA. Translation: AAQ82546.1.
AY305715 mRNA. Translation: AAQ82547.1.
AY423441 mRNA. Translation: AAQ99148.1.
AY423442 mRNA. Translation: AAQ99149.1.
AY423443 mRNA. Translation: AAQ99150.1.
AY428962 mRNA. Translation: AAR06908.1.
DQ849200 mRNA. Translation: ABI13589.1.
DQ849201 mRNA. Translation: ABI13590.1.
DQ849202 mRNA. Translation: ABI13591.1.
AK290377 mRNA. Translation: BAF83066.1.
AK291269 mRNA. Translation: BAF83958.1.
AC096670 Genomic DNA. Translation: AAY14797.1.
CH471237 Genomic DNA. Translation: EAW50365.1.
CH471237 Genomic DNA. Translation: EAW50367.1.
CH471237 Genomic DNA. Translation: EAW50369.1.
CH471237 Genomic DNA. Translation: EAW50370.1.
CH471237 Genomic DNA. Translation: EAW50371.1.
CH471237 Genomic DNA. Translation: EAW50372.1.
CH471237 Genomic DNA. Translation: EAW50373.1.
CH471237 Genomic DNA. Translation: EAW50374.1.
BC033694 mRNA. Translation: AAH33694.1.
CCDSiCCDS2089.1. [O43521-1]
CCDS2092.1. [O43521-17]
CCDS42731.1. [O43521-2]
CCDS56131.1. [O43521-16]
CCDS56132.1. [O43521-7]
CCDS56133.1. [O43521-9]
CCDS56134.1. [O43521-10]
CCDS56135.1. [O43521-8]
CCDS56136.1. [O43521-14]
CCDS74560.1. [O43521-4]
CCDS74561.1. [O43521-11]
RefSeqiNP_001191035.1. NM_001204106.1. [O43521-3]
NP_001191036.1. NM_001204107.1. [O43521-7]
NP_001191037.1. NM_001204108.1. [O43521-8]
NP_001191038.1. NM_001204109.1. [O43521-14]
NP_001191039.1. NM_001204110.1. [O43521-9]
NP_001191040.1. NM_001204111.1. [O43521-15]
NP_001191041.1. NM_001204112.1. [O43521-16]
NP_001191042.1. NM_001204113.1.
NP_006529.1. NM_006538.4. [O43521-2]
NP_619527.1. NM_138621.4. [O43521-1]
NP_619528.1. NM_138622.3. [O43521-4]
NP_619529.1. NM_138623.3. [O43521-5]
NP_619530.1. NM_138624.3. [O43521-10]
NP_619531.1. NM_138625.3.
NP_619532.1. NM_138626.3. [O43521-11]
NP_619533.1. NM_138627.3.
NP_996885.1. NM_207002.3. [O43521-17]
NP_996886.1. NM_207003.2. [O43521-6]
UniGeneiHs.469658.
Hs.737004.

Genome annotation databases

EnsembliENST00000308659; ENSP00000309226; ENSG00000153094. [O43521-2]
ENST00000337565; ENSP00000338374; ENSG00000153094. [O43521-17]
ENST00000361493; ENSP00000354879; ENSG00000153094.
ENST00000393256; ENSP00000376943; ENSG00000153094. [O43521-1]
ENST00000405953; ENSP00000384641; ENSG00000153094. [O43521-17]
ENST00000415458; ENSP00000393781; ENSG00000153094. [O43521-16]
ENST00000431217; ENSP00000394640; ENSG00000153094. [O43521-10]
ENST00000433098; ENSP00000401662; ENSG00000153094. [O43521-5]
ENST00000436733; ENSP00000403727; ENSG00000153094. [O43521-14]
ENST00000437029; ENSP00000412892; ENSG00000153094. [O43521-8]
ENST00000439718; ENSP00000411137; ENSG00000153094. [O43521-7]
ENST00000452231; ENSP00000391292; ENSG00000153094. [O43521-9]
ENST00000610735; ENSP00000481030; ENSG00000153094. [O43521-14]
ENST00000615946; ENSP00000481423; ENSG00000153094. [O43521-7]
ENST00000619294; ENSP00000479714; ENSG00000153094. [O43521-10]
ENST00000620862; ENSP00000478133; ENSG00000153094. [O43521-5]
ENST00000621302; ENSP00000481652; ENSG00000153094. [O43521-4]
ENST00000622509; ENSP00000482175; ENSG00000153094. [O43521-8]
ENST00000622612; ENSP00000484360; ENSG00000153094. [O43521-11]
GeneIDi10018.
KEGGihsa:10018.
UCSCiuc002tgt.1. human. [O43521-17]
uc002tgu.1. human. [O43521-2]
uc002tgv.1. human. [O43521-1]
uc002tgw.2. human. [O43521-6]
uc002tgx.2. human. [O43521-9]
uc002tgy.2. human. [O43521-16]
uc002tgz.2. human. [O43521-3]
uc002tha.2. human. [O43521-11]
uc002thb.2. human. [O43521-5]
uc002thc.2. human. [O43521-7]
uc002thd.2. human. [O43521-15]
uc010fkd.2. human. [O43521-13]
uc021vmp.1. human. [O43521-14]
uc021vmq.1. human. [O43521-4]
uc021vmr.1. human. [O43521-10]
uc021vms.1. human. [O43521-8]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF032457 mRNA. Translation: AAC39593.1 .
AF032458 mRNA. Translation: AAC39594.1 .
AB071195 mRNA. Translation: BAB78589.1 .
AB071196 mRNA. Translation: BAB78590.1 .
AB071197 mRNA. Translation: BAB78591.1 .
AB071198 mRNA. Translation: BAB78592.1 .
AB071199 mRNA. Translation: BAB78593.1 .
AB071200 mRNA. Translation: BAB78594.1 .
AY352518 mRNA. Translation: AAQ62569.1 .
AY305714 mRNA. Translation: AAQ82546.1 .
AY305715 mRNA. Translation: AAQ82547.1 .
AY423441 mRNA. Translation: AAQ99148.1 .
AY423442 mRNA. Translation: AAQ99149.1 .
AY423443 mRNA. Translation: AAQ99150.1 .
AY428962 mRNA. Translation: AAR06908.1 .
DQ849200 mRNA. Translation: ABI13589.1 .
DQ849201 mRNA. Translation: ABI13590.1 .
DQ849202 mRNA. Translation: ABI13591.1 .
AK290377 mRNA. Translation: BAF83066.1 .
AK291269 mRNA. Translation: BAF83958.1 .
AC096670 Genomic DNA. Translation: AAY14797.1 .
CH471237 Genomic DNA. Translation: EAW50365.1 .
CH471237 Genomic DNA. Translation: EAW50367.1 .
CH471237 Genomic DNA. Translation: EAW50369.1 .
CH471237 Genomic DNA. Translation: EAW50370.1 .
CH471237 Genomic DNA. Translation: EAW50371.1 .
CH471237 Genomic DNA. Translation: EAW50372.1 .
CH471237 Genomic DNA. Translation: EAW50373.1 .
CH471237 Genomic DNA. Translation: EAW50374.1 .
BC033694 mRNA. Translation: AAH33694.1 .
CCDSi CCDS2089.1. [O43521-1 ]
CCDS2092.1. [O43521-17 ]
CCDS42731.1. [O43521-2 ]
CCDS56131.1. [O43521-16 ]
CCDS56132.1. [O43521-7 ]
CCDS56133.1. [O43521-9 ]
CCDS56134.1. [O43521-10 ]
CCDS56135.1. [O43521-8 ]
CCDS56136.1. [O43521-14 ]
CCDS74560.1. [O43521-4 ]
CCDS74561.1. [O43521-11 ]
RefSeqi NP_001191035.1. NM_001204106.1. [O43521-3 ]
NP_001191036.1. NM_001204107.1. [O43521-7 ]
NP_001191037.1. NM_001204108.1. [O43521-8 ]
NP_001191038.1. NM_001204109.1. [O43521-14 ]
NP_001191039.1. NM_001204110.1. [O43521-9 ]
NP_001191040.1. NM_001204111.1. [O43521-15 ]
NP_001191041.1. NM_001204112.1. [O43521-16 ]
NP_001191042.1. NM_001204113.1.
NP_006529.1. NM_006538.4. [O43521-2 ]
NP_619527.1. NM_138621.4. [O43521-1 ]
NP_619528.1. NM_138622.3. [O43521-4 ]
NP_619529.1. NM_138623.3. [O43521-5 ]
NP_619530.1. NM_138624.3. [O43521-10 ]
NP_619531.1. NM_138625.3.
NP_619532.1. NM_138626.3. [O43521-11 ]
NP_619533.1. NM_138627.3.
NP_996885.1. NM_207002.3. [O43521-17 ]
NP_996886.1. NM_207003.2. [O43521-6 ]
UniGenei Hs.469658.
Hs.737004.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1F95 NMR - C/D 108-116 [» ]
2K7W NMR - B 145-164 [» ]
2NL9 X-ray 1.55 B 141-166 [» ]
2V6Q X-ray 2.70 B 141-166 [» ]
2VM6 X-ray 2.20 B 141-165 [» ]
2WH6 X-ray 1.50 B 141-166 [» ]
2YQ6 X-ray 1.80 B 147-164 [» ]
3D7V X-ray 2.03 B 141-166 [» ]
3FDL X-ray 1.78 B 141-166 [» ]
3IO8 X-ray 2.30 B/D 141-166 [» ]
3IO9 X-ray 2.40 B 141-166 [» ]
3KJ0 X-ray 1.70 B 143-165 [» ]
3KJ1 X-ray 1.94 B 143-163 [» ]
3KJ2 X-ray 2.35 B 143-163 [» ]
4B4S X-ray 1.90 B 141-166 [» ]
4D2M X-ray 2.10 B/D 141-166 [» ]
DisProti DP00643.
ProteinModelPortali O43521.
SMRi O43521. Positions 141-173.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115335. 44 interactions.
DIPi DIP-29185N.
IntActi O43521. 28 interactions.
MINTi MINT-1664421.

Chemistry

BindingDBi O43521.
ChEMBLi CHEMBL5777.

PTM databases

PhosphoSitei O43521.

Proteomic databases

MaxQBi O43521.
PaxDbi O43521.
PRIDEi O43521.

Protocols and materials databases

DNASUi 10018.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000308659 ; ENSP00000309226 ; ENSG00000153094 . [O43521-2 ]
ENST00000337565 ; ENSP00000338374 ; ENSG00000153094 . [O43521-17 ]
ENST00000361493 ; ENSP00000354879 ; ENSG00000153094 .
ENST00000393256 ; ENSP00000376943 ; ENSG00000153094 . [O43521-1 ]
ENST00000405953 ; ENSP00000384641 ; ENSG00000153094 . [O43521-17 ]
ENST00000415458 ; ENSP00000393781 ; ENSG00000153094 . [O43521-16 ]
ENST00000431217 ; ENSP00000394640 ; ENSG00000153094 . [O43521-10 ]
ENST00000433098 ; ENSP00000401662 ; ENSG00000153094 . [O43521-5 ]
ENST00000436733 ; ENSP00000403727 ; ENSG00000153094 . [O43521-14 ]
ENST00000437029 ; ENSP00000412892 ; ENSG00000153094 . [O43521-8 ]
ENST00000439718 ; ENSP00000411137 ; ENSG00000153094 . [O43521-7 ]
ENST00000452231 ; ENSP00000391292 ; ENSG00000153094 . [O43521-9 ]
ENST00000610735 ; ENSP00000481030 ; ENSG00000153094 . [O43521-14 ]
ENST00000615946 ; ENSP00000481423 ; ENSG00000153094 . [O43521-7 ]
ENST00000619294 ; ENSP00000479714 ; ENSG00000153094 . [O43521-10 ]
ENST00000620862 ; ENSP00000478133 ; ENSG00000153094 . [O43521-5 ]
ENST00000621302 ; ENSP00000481652 ; ENSG00000153094 . [O43521-4 ]
ENST00000622509 ; ENSP00000482175 ; ENSG00000153094 . [O43521-8 ]
ENST00000622612 ; ENSP00000484360 ; ENSG00000153094 . [O43521-11 ]
GeneIDi 10018.
KEGGi hsa:10018.
UCSCi uc002tgt.1. human. [O43521-17 ]
uc002tgu.1. human. [O43521-2 ]
uc002tgv.1. human. [O43521-1 ]
uc002tgw.2. human. [O43521-6 ]
uc002tgx.2. human. [O43521-9 ]
uc002tgy.2. human. [O43521-16 ]
uc002tgz.2. human. [O43521-3 ]
uc002tha.2. human. [O43521-11 ]
uc002thb.2. human. [O43521-5 ]
uc002thc.2. human. [O43521-7 ]
uc002thd.2. human. [O43521-15 ]
uc010fkd.2. human. [O43521-13 ]
uc021vmp.1. human. [O43521-14 ]
uc021vmq.1. human. [O43521-4 ]
uc021vmr.1. human. [O43521-10 ]
uc021vms.1. human. [O43521-8 ]

Organism-specific databases

CTDi 10018.
GeneCardsi GC02P111876.
HGNCi HGNC:994. BCL2L11.
HPAi CAB026332.
MIMi 603827. gene.
neXtProti NX_O43521.
PharmGKBi PA25305.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG40262.
GeneTreei ENSGT00390000003178.
InParanoidi O43521.
KOi K16341.
OMAi EMPITSH.
PhylomeDBi O43521.
TreeFami TF335898.

Enzyme and pathway databases

Reactomei REACT_13638. NRAGE signals death through JNK.
REACT_330. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.

Miscellaneous databases

ChiTaRSi BCL2L11. human.
EvolutionaryTracei O43521.
GeneWikii BCL2L11.
GenomeRNAii 10018.
NextBioi 37849.
PMAP-CutDB O43521.
PROi O43521.
SOURCEi Search...

Gene expression databases

Bgeei O43521.
ExpressionAtlasi O43521. baseline and differential.
Genevestigatori O43521.

Family and domain databases

InterProi IPR014771. Apoptosis_Bim_N.
IPR017288. Bcl-2-like_11.
IPR015040. Bcl-x_interacting_BH3_dom.
[Graphical view ]
Pfami PF08945. Bclx_interact. 1 hit.
PF06773. Bim_N. 1 hit.
[Graphical view ]
PIRSFi PIRSF037827. Bcl-2-like_p11. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Bim: a novel member of the Bcl-2 family that promotes apoptosis."
    O'Connor L., Strasser A., O'Reilly L.A., Hausmann G., Adams J.M., Cory S., Huang D.C.S.
    EMBO J. 17:384-395(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMEL AND BIML), FUNCTION.
    Tissue: Peripheral blood and Spleen.
  2. "Molecular cloning and characterization of six novel isoforms of human Bim, a member of the proapoptotic Bcl-2 family."
    Mami U., Miyashita T., Shikama Y., Tadokoro K., Yamada M.
    FEBS Lett. 509:135-141(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIM-ALPHA1; BIM-ALPHA2; BIM-BETA1; BIM-BETA2; BIM-BETA3 AND BIM-BETA4), FUNCTION (ISOFORMS BIM-ALPHA1 AND BIM-ALPHA2), SUBCELLULAR LOCATION.
  3. "Identification and characterization of Bimgamma, a novel proapoptotic BH3-only splice variant of Bim."
    Liu J.-W., Chandra D., Tang S.H., Chopra D., Tang D.G.
    Cancer Res. 62:2976-2981(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BIM-GAMMA), FUNCTION (ISOFORM BIM-GAMMA), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  4. "Identification of novel isoforms of the BH3 domain protein Bim which directly activate Bax to trigger apoptosis."
    Marani M., Tenev T., Hancock D., Downward J., Lemoine N.R.
    Mol. Cell. Biol. 22:3577-3589(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMEL; BIML; BIMS; BIM-ALPHA1; BIM-ALPHA2; BIM-ALPHA3; BIMA; BIMABC AND BIMAC), ALTERNATIVE SPLICING, FUNCTION, SUBUNIT, MUTAGENESIS OF GLY-156 AND ASN-160.
    Tissue: Embryonic kidney and Ovarian cancer.
  5. "Over-expression of Bim alpha3, a novel isoform of human Bim, result in cell apoptosis."
    Chen J.Z., Ji C.N., Gu S.H., Li J.X., Zhao E.P., Huang Y., Huang L., Ying K., Xie Y., Mao Y.M.
    Int. J. Biochem. Cell Biol. 36:1554-1561(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMS AND BIM-ALPHA3), FUNCTION (ISOFORM BIM-ALPHA3).
  6. "Identification and characterization of BH3 domain protein Bim and its isoforms in human hepatocellular carcinomas."
    Miao J., Chen G.G., Yun J.P., Chun S.Y., Zheng Z.Z., Ho R.L.K., Chak E.C., Xia N.S., Lai P.B.
    Apoptosis 12:1691-1701(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIM-ALPHA3; BIM-ALPHA4; BIM-ALPHA5; BIM-ALPHA6; BIM-BETA5; BIM-BETA6; BIM-BETA7).
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS BIMEL AND BIML).
    Tissue: Teratocarcinoma and Tongue.
  8. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BIMEL).
    Tissue: Blood.
  11. "BimEL is an important determinant for induction of anoikis sensitivity by mitogen-activated protein/extracellular signal-regulated kinase kinase inhibitors."
    Fukazawa H., Noguchi K., Masumi A., Murakami Y., Uehara Y.
    Mol. Cancer Ther. 3:1281-1288(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-69, UBIQUITINATION.
  12. Cited for: MUTAGENESIS OF GLY-156.
  13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  14. "Identification of a novel Bcl-2-interacting mediator of cell death (Bim) E3 ligase, tripartite motif-containing protein 2 (TRIM2), and its role in rapid ischemic tolerance-induced neuroprotection."
    Thompson S., Pearson A.N., Ashley M.D., Jessick V., Murphy B.M., Gafken P., Henshall D.C., Morris K.T., Simon R.P., Meller R.
    J. Biol. Chem. 286:19331-19339(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TRIM2.
  15. "CHOP potentially co-operates with FOXO3a in neuronal cells to regulate PUMA and BIM expression in response to ER stress."
    Ghosh A.P., Klocke B.J., Ballestas M.E., Roth K.A.
    PLoS ONE 7:E39586-E39586(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION BY ER STRESS.
  16. Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 141-166 IN COMPLEX WITH MCL1.
  17. "Completing the family portrait of the anti-apoptotic Bcl-2 proteins: crystal structure of human Bfl-1 in complex with Bim."
    Herman M.D., Nyman T., Welin M., Lehtio L., Flodin S., Tresaugues L., Kotenyova T., Flores A., Nordlund P.
    FEBS Lett. 582:3590-3594(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 141-165 IN COMPLEX WITH BCL2A1.

Entry informationi

Entry nameiB2L11_HUMAN
AccessioniPrimary (citable) accession number: O43521
Secondary accession number(s): A8K2W2
, O43522, Q0MSE7, Q0MSE8, Q0MSE9, Q53R28, Q6JTU6, Q6T851, Q6TE14, Q6TE15, Q6TE16, Q6V402, Q8WYL6, Q8WYL7, Q8WYL8, Q8WYL9, Q8WYM0, Q8WYM1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: June 1, 1998
Last modified: November 26, 2014
This is version 142 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3