Reviewed,
UniProtKB/Swiss-Prot O43521 (B2L11_HUMAN)
Last modified
November 3, 2009.
Version 87.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Bcl-2-like protein 11 Short name=Bcl2-L-11 Alternative name(s): Bcl2-interacting mediator of cell death | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 198 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Induces apoptosis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than the isoforms BimEL, BimL and BimS. Isoform Bim-gamma induces apoptosis. Ref.1 Ref.2 Ref.3 Ref.4 |
| Subunit structure | Forms heterodimers with a number of antiapoptotic Bcl-2 proteins including MCL1, BCL2, BCL2L1 isoform Bcl-X(L), BCL2A1/BFL-1, and BHRF1. Does not heterodimerize with proapoptotic proteins such as BAD, BOK, BAX or BAK By similarity. |
| Subcellular location | Endomembrane system; Peripheral membrane protein By similarity. Note: Associated with intracytoplasmic membranes By similarity. Isoform BimEL: Mitochondrion. Ref.2 Ref.3 Isoform BimL: Mitochondrion. Ref.2 Ref.3 Isoform BimS: Mitochondrion. Ref.2 Ref.3 Isoform Bim-alpha1: Mitochondrion. Ref.2 Ref.3 |
| Tissue specificity | Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are ubiquitously expressed with a tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney. Ref.3 |
| Domain | The BH3 motif is required for Bcl-2 binding and cytotoxicity. |
| Sequence similarities | Belongs to the Bcl-2 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Membrane Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | activation of pro-apoptotic gene products Inferred from Experiment. Source: Reactome induction of apoptosis by extracellular signalsInferred from Experiment. Source: Reactome |
| Cellular component | cytosol Inferred from Experiment. Source: Reactome extrinsic to membraneInferred from electronic annotation. Source: UniProtKB-SubCell mitochondrial outer membraneInferred from Experiment. Source: Reactome plasma membraneInferred from Experiment. Source: Reactome |
| Molecular function | protein binding Inferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AKT1 | P31749 | 1 | EBI-526416,EBI-296087 | |
| BCL2 | P10415 | 2 | EBI-526406,EBI-77694 | |
| BCL2 | P10415 | 1 | EBI-526416,EBI-77694 | |
| BCL2 | P10415 | 2 | EBI-526420,EBI-77694 | |
| BCL2A1 | Q16548 | 1 | EBI-526406,EBI-1003550 | |
| Bcl2a1 | Q07440 | 1 | EBI-526406,EBI-707754 | From a different organism. |
| BCL2L1 | Q07817 | 1 | EBI-526406,EBI-78035 | |
| BCL2L1 | Q07817-1 | 4 | EBI-526406,EBI-287195 | |
| BCL2L1 | Q07817-1 | 1 | EBI-526416,EBI-287195 | |
| BCL2L2 | Q92843 | 2 | EBI-526406,EBI-707714 | |
| DYNLRB1 | Q9NP97 | 1 | EBI-526406,EBI-372128 | |
| GNB2L1 | P63244 | 2 | EBI-526406,EBI-296739 | |
| Mapk1 | P63085 | 1 | EBI-526416,EBI-397697 | From a different organism. |
| MCL1 | Q07820 | 1 | EBI-526406,EBI-1003422 | |
| Mcl1 | P97287 | 3 | EBI-526406,EBI-707292 | From a different organism. |
| MIF | P14174 | 1 | EBI-2123748,EBI-372712 | |
| MIF | P14174 | 1 | EBI-526416,EBI-372712 | |
| MIF | P14174 | 5 | EBI-526420,EBI-372712 | |
| YWHAB | P31946 | 1 | EBI-526406,EBI-359815 |
Alternative products
| This entry describes 17 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform BimEL (identifier: O43521-1) Also known as: Bim(EL); This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform BimL (identifier: O43521-2) Also known as: Bim(L); The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. | ||||||
| Isoform BimS (identifier: O43521-3) Also known as: BCL2-like 11 transcript variant 9; Bim(S); The sequence of this isoform differs from the canonical sequence as follows: 42-131: Missing. | ||||||
| Isoform Bim-alpha1 (identifier: O43521-4) The sequence of this isoform differs from the canonical sequence as follows: 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK | ||||||
| Isoform Bim-alpha2 (identifier: O43521-5) The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK | ||||||
| Isoform Bim-alpha3 (identifier: O43521-6) Also known as: BCL2-like 11 transcript variant 10; The sequence of this isoform differs from the canonical sequence as follows: 42-131: Missing. 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK | ||||||
| Isoform Bim-alpha4 (identifier: O43521-7) The sequence of this isoform differs from the canonical sequence as follows: 42-131: Missing. 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LAKLLASST | ||||||
| Isoform Bim-alpha5 (identifier: O43521-8) The sequence of this isoform differs from the canonical sequence as follows: 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD | ||||||
| Isoform Bim-alpha6 (identifier: O43521-9) The sequence of this isoform differs from the canonical sequence as follows: 42-131: Missing. 167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD | ||||||
| Isoform Bim-beta1 (identifier: O43521-10) The sequence of this isoform differs from the canonical sequence as follows: 133-135: SMR → NWD 136-198: Missing. | ||||||
| Isoform Bim-beta2 (identifier: O43521-11) The sequence of this isoform differs from the canonical sequence as follows: 132-135: ASMR → GIFE 136-198: Missing. | ||||||
| Isoform Bim-beta3 (identifier: O43521-12) The sequence of this isoform differs from the canonical sequence as follows: 42-75: GNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFAT → VSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK | ||||||
| Isoform Bim-beta4 (identifier: O43521-13) The sequence of this isoform differs from the canonical sequence as follows: 43-44: NP → IF 45-198: Missing. | ||||||
| Isoform Bim-beta5 (identifier: O43521-14) The sequence of this isoform differs from the canonical sequence as follows: 132-140: ASMRQAEPA → VREIEEVVV 141-198: Missing. | ||||||
| Isoform Bim-beta6 (identifier: O43521-15) The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. 132-135: ASMR → GIFE 136-198: Missing. | ||||||
| Isoform Bim-beta7 (identifier: O43521-16) The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. 132-140: ASMRQAEPA → VREIEEVVV 141-198: Missing. | ||||||
| Isoform Bim-gamma (identifier: O43521-17) The sequence of this isoform differs from the canonical sequence as follows: 42-101: Missing. 132-198: ASMRQAEPAD...YIVRLVWRMH → VVILEDIGDL...TEQLNHKDFS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 198 | 198 | Bcl-2-like protein 11 | PRO_0000143109 | |||||||
Regions | |||||||||||
| Motif | 148 – 162 | 15 | BH3 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 77 | 1 | Phosphoserine Ref.10 Ref.11 | ||||||||
| Modified residue | 87 | 1 | Phosphoserine By similarity | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 42 – 131 | 90 | Missing in isoform BimS, isoform Bim-alpha3, isoform Bim-alpha6 and isoform Bim-alpha4. | VSP_035608 | |||||||
| Alternative sequence | 42 – 101 | 60 | Missing in isoform BimL, isoform Bim-alpha2, isoform Bim-gamma, isoform Bim-beta6 and isoform Bim-beta7. | VSP_000535 | |||||||
| Alternative sequence | 42 – 75 | 34 | GNPEG…GPFAT → VSLCHPGWSALVRSWLTATS NSQVQAVLLPQPPK in isoform Bim-beta3. | VSP_035609 | |||||||
| Alternative sequence | 43 – 44 | 2 | NP → IF in isoform Bim-beta4. | VSP_035610 | |||||||
| Alternative sequence | 45 – 198 | 154 | Missing in isoform Bim-beta4. | VSP_035611 | |||||||
| Alternative sequence | 132 – 198 | 67 | ASMRQ…VWRMH → VVILEDIGDLSLCFGFIFTG LDLYGHHHSQDTEQLNHKDF S in isoform Bim-gamma. | VSP_035612 | |||||||
| Alternative sequence | 132 – 140 | 9 | ASMRQAEPA → VREIEEVVV in isoform Bim-beta5 and isoform Bim-beta7. | VSP_035613 | |||||||
| Alternative sequence | 132 – 135 | 4 | ASMR → GIFE in isoform Bim-beta2 and isoform Bim-beta6. | VSP_035614 | |||||||
| Alternative sequence | 133 – 135 | 3 | SMR → NWD in isoform Bim-beta1. | VSP_035615 | |||||||
| Alternative sequence | 136 – 198 | 63 | Missing in isoform Bim-beta1, isoform Bim-beta2 and isoform Bim-beta6. | VSP_035616 | |||||||
| Alternative sequence | 141 – 198 | 58 | Missing in isoform Bim-beta5 and isoform Bim-beta7. | VSP_035617 | |||||||
| Alternative sequence | 167 – 198 | 32 | VFLNN…VWRMH → LEK in isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3. | VSP_035620 | |||||||
| Alternative sequence | 167 – 198 | 32 | VFLNN…VWRMH → LAKLLASST in isoform Bim-alpha4. | VSP_035618 | |||||||
| Alternative sequence | 167 – 198 | 32 | VFLNN…VWRMH → MPLPPD in isoform Bim-alpha5 and isoform Bim-alpha6. | VSP_035619 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 33 | 1 | P → L in BAF83066. Ref.6 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 144 – 164 | 21 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Bim: a novel member of the Bcl-2 family that promotes apoptosis." O'Connor L., Strasser A., O'Reilly L.A., Hausmann G., Adams J.M., Cory S., Huang D.C.S. EMBO J. 17:384-395(1998) [PubMed: 9430630] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMEL AND BIML), FUNCTION. Tissue: Peripheral blood and Spleen. |
| [2] | "Molecular cloning and characterization of six novel isoforms of human Bim, a member of the proapoptotic Bcl-2 family." Mami U., Miyashita T., Shikama Y., Tadokoro K., Yamada M. FEBS Lett. 509:135-141(2001) [PubMed: 11734221] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIM-ALPHA1; BIM-ALPHA2; BIM-BETA1; BIM-BETA2; BIM-BETA3 AND BIM-BETA4), FUNCTION (ISOFORMS BIM-ALPHA1 AND BIM-ALPHA2), SUBCELLULAR LOCATION. |
| [3] | "Identification and characterization of Bimgamma, a novel proapoptotic BH3-only splice variant of Bim." Liu J.-W., Chandra D., Tang S.H., Chopra D., Tang D.G. Cancer Res. 62:2976-2981(2002) [PubMed: 12019181] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BIM-GAMMA), FUNCTION (ISOFORM BIM-GAMMA), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [4] | "Over-expression of Bim alpha3, a novel isoform of human Bim, result in cell apoptosis." Chen J.Z., Ji C.N., Gu S.H., Li J.X., Zhao E.P., Huang Y., Huang L., Ying K., Xie Y., Mao Y.M. Int. J. Biochem. Cell Biol. 36:1554-1561(2004) [PubMed: 15147734] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMS AND BIM-ALPHA3), FUNCTION (ISOFORM BIM-ALPHA3). |
| [5] | "Identification and characterization of BH3 domain protein Bim and its isoforms in human hepatocellular carcinomas." Miao J., Chen G.G., Yun J.P., Chun S.Y., Zheng Z.Z., Ho R.L.K., Chak E.C., Xia N.S., Lai P.B. Apoptosis 12:1691-1701(2007) [PubMed: 17503221] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIM-ALPHA3; BIM-ALPHA4; BIM-ALPHA5; BIM-ALPHA6; BIM-BETA5; BIM-BETA6; BIM-BETA7). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS BIMEL AND BIML). Tissue: Teratocarcinoma and Tongue. |
| [7] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BIMEL). Tissue: Blood. |
| [10] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-77, MASS SPECTROMETRY. |
| [11] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-77, MASS SPECTROMETRY. |
| [12] | "Structural insights into the degradation of Mcl-1 induced by BH3 domains." Czabotar P.E., Lee E.F., van Delft M.F., Day C.L., Smith B.J., Huang D.C.S., Fairlie W.D., Hinds M.G., Colman P.M. Proc. Natl. Acad. Sci. U.S.A. 104:6217-6222(2007) [PubMed: 17389404] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 141-166 IN COMPLEX WITH MCL1. |
| [13] | "Human BCL-2A1 in complex with BIM." Structural genomics consortium (SGC) Submitted (FEB-2008) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 141-165 IN COMPLEX WITH BCL2A1. |
| + | Additional computationally mapped references. |
Cross-references
Entry information
| Entry name | B2L11_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43521 Secondary accession number(s): A8K2W2 Q8WYM1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


