Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2-like protein 11

Gene

BCL2L11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.3 Publications

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000153094-MONOMER.
ReactomeiR-HSA-111446. Activation of BIM and translocation to mitochondria.
R-HSA-111453. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.
R-HSA-193648. NRAGE signals death through JNK.
R-HSA-6802952. Signaling by BRAF and RAF fusions.
SIGNORiO43521.

Protein family/group databases

TCDBi8.A.69.1.1. the pro-apoptotic bcl-2-family protein bim (bim) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2-like protein 11
Short name:
Bcl2-L-11
Alternative name(s):
Bcl2-interacting mediator of cell death
Gene namesi
Name:BCL2L11
Synonyms:BIM
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:994. BCL2L11.

Subcellular locationi

Isoform BimEL :
  • Mitochondrion

  • Note: Translocates from microtubules to motochondria on loss of cell adherence.

GO - Cellular componenti

  • BIM-BCL-2 complex Source: UniProtKB
  • BIM-BCL-xl complex Source: UniProtKB
  • cytoplasmic dynein complex Source: Ensembl
  • cytosol Source: UniProtKB
  • endomembrane system Source: UniProtKB-SubCell
  • extrinsic component of membrane Source: Ensembl
  • mitochondrial outer membrane Source: Reactome
  • mitochondrion Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi156G → A: Retains the ability to induce apoptosis. Abolishes interaction with BAX; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BCL2. 2 Publications1
Mutagenesisi156G → E: Abolishes induction of apoptosis. Abolishes interaction with BAX and BCL2; in isoform Bim-alpha3 and isoform BimS. Loses the ability to induce the conformationally active form of BAX. 2 Publications1
Mutagenesisi160N → A: Retains the ability to induce apoptosis. Abolishes interaction with BCL2; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BAX. 1 Publication1

Organism-specific databases

DisGeNETi10018.
OpenTargetsiENSG00000153094.
PharmGKBiPA25305.

Chemistry databases

ChEMBLiCHEMBL5777.

Polymorphism and mutation databases

BioMutaiBCL2L11.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001431091 – 198Bcl-2-like protein 11Add BLAST198

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei69Phosphoserine; by MAPK1 Publication1
Modified residuei77PhosphoserineBy similarity1
Modified residuei87PhosphoserineBy similarity1
Modified residuei94PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylation at Ser-69 by MAPK1/MAPK3 leads to interaction with TRIM2 and polyubiquitination, followed by proteasomal degradation (PubMed:15486195, PubMed:21478148). Deubiquitination catalyzed by USP27X stabilizes the protein (By similarity).By similarity2 Publications
Ubiquitination by TRIM2 following phosphorylation by MAPK1/MAPK3 leads to proteasomal degradation. Conversely, deubiquitination catalyzed by USP27X stabilizes the protein.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiO43521.
PaxDbiO43521.
PeptideAtlasiO43521.
PRIDEiO43521.

PTM databases

iPTMnetiO43521.
PhosphoSitePlusiO43521.

Miscellaneous databases

PMAP-CutDBO43521.

Expressioni

Tissue specificityi

Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are widely expressed with tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney.1 Publication

Inductioni

By ER stress in a DDIT3/CHOP-dependent manner.1 Publication

Gene expression databases

BgeeiENSG00000153094.
ExpressionAtlasiO43521. baseline and differential.
GenevisibleiO43521. HS.

Organism-specific databases

HPAiCAB026332.

Interactioni

Subunit structurei

Forms heterodimers with a number of antiapoptotic Bcl-2 proteins, including MCL1, BCL2, BCL2L1 isoform Bcl-X(L), BCL2A1/BFL-1, BHRF1, and BCL2L2/BCLW (PubMed:11997495, PubMed:27013495, PubMed:18812174). Isoform BimS and isoform Bim-alpha3 interact with BAX; this interaction may lead to BAX activation through conformational change (PubMed:11997495). Does not heterodimerize with proapoptotic proteins such as BAD, BOK or BAK. Identified in a complex containing BCL2L11, DYNLL1 and BCL2L1 isoform Bcl-X(L); BH3 integrity is required for BCL2L1-binding. Interacts with YWHAZ. When phosphorylated, interacts with TRIM2; this interaction is associated with ubiquitination and degradation (PubMed:21478148). Interacts with MCL1; may sequester BCL2L11 to prevent its pro-apoptotic activity (PubMed:27013495, PubMed:17389404). When phosphorylated, isoform BimEL interacts with USP27X; this interaction leads to BCL2L11 deubiquitination and stabilization (PubMed:27013495).5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BADQ929342EBI-526406,EBI-700771
BAXQ0781219EBI-526406,EBI-516580
BCL2P104158EBI-526406,EBI-77694
Bcl2a1Q074402EBI-526406,EBI-707754From a different organism.
BCL2L1Q078172EBI-526406,EBI-78035
BCL2L1Q07817-110EBI-526406,EBI-287195
BCL2L2Q928434EBI-526406,EBI-707714
F1LP684514EBI-526406,EBI-7066119From a different organism.
MAGEA11P43364-23EBI-526406,EBI-10178634
MCL1Q0782015EBI-526406,EBI-1003422
Mcl1P972877EBI-526406,EBI-707292From a different organism.
MIFP141745EBI-526420,EBI-372712
NSP034952EBI-526406,EBI-2548993From a different organism.
RACK1P632442EBI-526406,EBI-296739

Protein-protein interaction databases

BioGridi115335. 54 interactors.
DIPiDIP-29185N.
IntActiO43521. 32 interactors.
MINTiMINT-1664421.
STRINGi9606.ENSP00000376943.

Chemistry databases

BindingDBiO43521.

Structurei

Secondary structure

1198
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi112 – 115Combined sources4
Helixi143 – 159Combined sources17
Turni160 – 163Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F95NMR-C/D108-116[»]
2K7WNMR-B145-164[»]
2NL9X-ray1.55B141-166[»]
2V6QX-ray2.70B141-166[»]
2VM6X-ray2.20B141-165[»]
2WH6X-ray1.50B141-166[»]
2YQ6X-ray1.80B147-164[»]
2YQ7X-ray1.90B147-164[»]
3D7VX-ray2.03B141-166[»]
3FDLX-ray1.78B141-166[»]
3IO8X-ray2.30B/D141-166[»]
3IO9X-ray2.40B141-166[»]
3KJ0X-ray1.70B143-165[»]
3KJ1X-ray1.94B143-163[»]
3KJ2X-ray2.35B143-163[»]
4A1UX-ray1.54B146-163[»]
4A1WX-ray2.50P/Q/R/S146-163[»]
4B4SX-ray1.90B141-166[»]
4D2MX-ray2.10B/D141-166[»]
4QVFX-ray1.53B141-166[»]
4UF3X-ray2.70B141-166[»]
4YJ4X-ray2.10B146-165[»]
4ZIEX-ray1.80C141-166[»]
4ZIFX-ray2.40B141-160[»]
4ZIHX-ray2.50B141-160[»]
5AGWX-ray2.69C/D146-166[»]
5AGXX-ray2.24C/D146-166[»]
5C3GX-ray2.45B146-166[»]
DisProtiDP00643.
ProteinModelPortaliO43521.
SMRiO43521.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO43521.

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi148 – 162BH3Add BLAST15

Domaini

The BH3 motif is required for interaction with Bcl-2 proteins and cytotoxicity.By similarity

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

eggNOGiENOG410IZKS. Eukaryota.
ENOG410Y8GB. LUCA.
GeneTreeiENSGT00390000003178.
InParanoidiO43521.
KOiK16341.
OMAiAEDHPQM.
OrthoDBiEOG091G0XD3.
PhylomeDBiO43521.
TreeFamiTF335898.

Family and domain databases

InterProiIPR014771. Apoptosis_Bim_N.
IPR017288. Bcl-2-like_11.
IPR015040. Bcl-x_interacting_BH3_dom.
[Graphical view]
PfamiPF08945. Bclx_interact. 1 hit.
PF06773. Bim_N. 1 hit.
[Graphical view]
PIRSFiPIRSF037827. Bcl-2-like_p11. 1 hit.

Sequences (20)i

Sequence statusi: Complete.

This entry describes 20 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform BimEL (identifier: O43521-1) [UniParc]FASTAAdd to basket
Also known as: Bim(EL)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKQPSDVSS ECDREGRQLQ PAERPPQLRP GAPTSLQTEP QGNPEGNHGG
60 70 80 90 100
EGDSCPHGSP QGPLAPPASP GPFATRSPLF IFMRRSSLLS RSSSGYFSFD
110 120 130 140 150
TDRSPAPMSC DKSTQTPSPP CQAFNHYLSA MASMRQAEPA DMRPEIWIAQ
160 170 180 190
ELRRIGDEFN AYYARRVFLN NYQAAEDHPR MVILRLLRYI VRLVWRMH
Length:198
Mass (Da):22,171
Last modified:June 1, 1998 - v1
Checksum:iD75735E469CA6997
GO
Isoform BimL (identifier: O43521-2) [UniParc]FASTAAdd to basket
Also known as: Bim(L)

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.

Show »
Length:138
Mass (Da):15,967
Checksum:i8BB4AAE06CB080FA
GO
Isoform BimS (identifier: O43521-3) [UniParc]FASTAAdd to basket
Also known as: BCL2-like 11 transcript variant 9, Bim(S)

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.

Show »
Length:108
Mass (Da):12,717
Checksum:i60067208524D5BEA
GO
Isoform Bim-alpha1 (identifier: O43521-4) [UniParc]FASTAAdd to basket
Also known as: BimABCD, Bim-ABCD

The sequence of this isoform differs from the canonical sequence as follows:
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

Show »
Length:169
Mass (Da):18,536
Checksum:iE2E24D5697C955BA
GO
Isoform Bim-alpha2 (identifier: O43521-5) [UniParc]FASTAAdd to basket
Also known as: BimACD, Bim-ACD

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

Show »
Length:109
Mass (Da):12,332
Checksum:i4335FA21C13B49AD
GO
Isoform Bim-alpha3 (identifier: O43521-6) [UniParc]FASTAAdd to basket
Also known as: BCL2-like 11 transcript variant 10, BimAD, Bim-AD

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

Show »
Length:79
Mass (Da):9,081
Checksum:i3E03CCF2154A242C
GO
Isoform Bim-alpha4 (identifier: O43521-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LAKLLASST

Show »
Length:85
Mass (Da):9,596
Checksum:i7A6FD9AF07DA3E05
GO
Isoform Bim-alpha5 (identifier: O43521-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD

Show »
Length:172
Mass (Da):18,816
Checksum:iD2F7FC06EE3CE697
GO
Isoform Bim-alpha6 (identifier: O43521-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD

Show »
Length:82
Mass (Da):9,362
Checksum:i08678A7A0FBD4215
GO
Isoform Bim-beta1 (identifier: O43521-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-135: SMR → NWD
     136-198: Missing.

Show »
Length:135
Mass (Da):14,458
Checksum:iD208F1CB6D324539
GO
Isoform Bim-beta2 (identifier: O43521-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-135: ASMR → GIFE
     136-198: Missing.

Show »
Length:135
Mass (Da):14,418
Checksum:iD3A245DECD324539
GO
Isoform Bim-beta3 (identifier: O43521-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-75: GNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFAT → VSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK

Show »
Length:198
Mass (Da):22,649
Checksum:iA8FA866EBD5CF16E
GO
Isoform Bim-beta4 (identifier: O43521-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-44: NP → IF
     45-198: Missing.

Show »
Length:44
Mass (Da):4,834
Checksum:iFA9541901CA32FD1
GO
Isoform Bim-beta5 (identifier: O43521-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-140: ASMRQAEPA → VREIEEVVV
     141-198: Missing.

Show »
Length:140
Mass (Da):15,025
Checksum:iB7590CC04A98E081
GO
Isoform Bim-beta6 (identifier: O43521-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-135: ASMR → GIFE
     136-198: Missing.

Show »
Length:75
Mass (Da):8,214
Checksum:i7CFE6B5A5ED671F3
GO
Isoform Bim-beta7 (identifier: O43521-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-140: ASMRQAEPA → VREIEEVVV
     141-198: Missing.

Show »
Length:80
Mass (Da):8,821
Checksum:i6958582B30D7BCAF
GO
Isoform Bim-gamma (identifier: O43521-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-198: ASMRQAEPAD...YIVRLVWRMH → VVILEDIGDL...TEQLNHKDFS

Show »
Length:112
Mass (Da):12,412
Checksum:i15E21254C12C239B
GO
Isoform BimABC (identifier: O43521-18) [UniParc]FASTAAdd to basket
Also known as: Bim-ABC

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-166: Missing.

Show »
Length:103
Mass (Da):11,773
Checksum:iFD4F4A9292591961
GO
Isoform BimAC (identifier: O43521-19) [UniParc]FASTAAdd to basket
Also known as: Bim-AC

The sequence of this isoform differs from the canonical sequence as follows:
     132-166: Missing.

Show »
Length:163
Mass (Da):17,977
Checksum:i215890B3975C25A5
GO
Isoform BimA (identifier: O43521-20) [UniParc]FASTAAdd to basket
Also known as: Bim-A

The sequence of this isoform differs from the canonical sequence as follows:
     42-166: Missing.

Show »
Length:73
Mass (Da):8,523
Checksum:iD0CE170469B8570D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti33P → L in BAF83066 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04286542 – 166Missing in isoform BimA. 1 PublicationAdd BLAST125
Alternative sequenceiVSP_03560842 – 131Missing in isoform BimS, isoform Bim-alpha3, isoform Bim-alpha6 and isoform Bim-alpha4. 3 PublicationsAdd BLAST90
Alternative sequenceiVSP_00053542 – 101Missing in isoform BimABC, isoform BimL, isoform Bim-alpha2, isoform Bim-gamma, isoform Bim-beta6 and isoform Bim-beta7. 6 PublicationsAdd BLAST60
Alternative sequenceiVSP_03560942 – 75GNPEG…GPFAT → VSLCHPGWSALVRSWLTATS NSQVQAVLLPQPPK in isoform Bim-beta3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_03561043 – 44NP → IF in isoform Bim-beta4. 1 Publication2
Alternative sequenceiVSP_03561145 – 198Missing in isoform Bim-beta4. 1 PublicationAdd BLAST154
Alternative sequenceiVSP_035612132 – 198ASMRQ…VWRMH → VVILEDIGDLSLCFGFIFTG LDLYGHHHSQDTEQLNHKDF S in isoform Bim-gamma. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_042866132 – 166Missing in isoform BimAC and isoform BimABC. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_035613132 – 140ASMRQAEPA → VREIEEVVV in isoform Bim-beta5 and isoform Bim-beta7. 1 Publication9
Alternative sequenceiVSP_035614132 – 135ASMR → GIFE in isoform Bim-beta2 and isoform Bim-beta6. 2 Publications4
Alternative sequenceiVSP_035615133 – 135SMR → NWD in isoform Bim-beta1. 1 Publication3
Alternative sequenceiVSP_035616136 – 198Missing in isoform Bim-beta1, isoform Bim-beta2 and isoform Bim-beta6. 2 PublicationsAdd BLAST63
Alternative sequenceiVSP_035617141 – 198Missing in isoform Bim-beta5 and isoform Bim-beta7. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_035620167 – 198VFLNN…VWRMH → LEK in isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3. 4 PublicationsAdd BLAST32
Alternative sequenceiVSP_035618167 – 198VFLNN…VWRMH → LAKLLASST in isoform Bim-alpha4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_035619167 – 198VFLNN…VWRMH → MPLPPD in isoform Bim-alpha5 and isoform Bim-alpha6. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF032457 mRNA. Translation: AAC39593.1.
AF032458 mRNA. Translation: AAC39594.1.
AB071195 mRNA. Translation: BAB78589.1.
AB071196 mRNA. Translation: BAB78590.1.
AB071197 mRNA. Translation: BAB78591.1.
AB071198 mRNA. Translation: BAB78592.1.
AB071199 mRNA. Translation: BAB78593.1.
AB071200 mRNA. Translation: BAB78594.1.
AY352518 mRNA. Translation: AAQ62569.1.
AY305714 mRNA. Translation: AAQ82546.1.
AY305715 mRNA. Translation: AAQ82547.1.
AY423441 mRNA. Translation: AAQ99148.1.
AY423442 mRNA. Translation: AAQ99149.1.
AY423443 mRNA. Translation: AAQ99150.1.
AY428962 mRNA. Translation: AAR06908.1.
DQ849200 mRNA. Translation: ABI13589.1.
DQ849201 mRNA. Translation: ABI13590.1.
DQ849202 mRNA. Translation: ABI13591.1.
AK290377 mRNA. Translation: BAF83066.1.
AK291269 mRNA. Translation: BAF83958.1.
AC096670 Genomic DNA. Translation: AAY14797.1.
CH471237 Genomic DNA. Translation: EAW50365.1.
CH471237 Genomic DNA. Translation: EAW50367.1.
CH471237 Genomic DNA. Translation: EAW50369.1.
CH471237 Genomic DNA. Translation: EAW50370.1.
CH471237 Genomic DNA. Translation: EAW50371.1.
CH471237 Genomic DNA. Translation: EAW50372.1.
CH471237 Genomic DNA. Translation: EAW50373.1.
CH471237 Genomic DNA. Translation: EAW50374.1.
BC033694 mRNA. Translation: AAH33694.1.
CCDSiCCDS2089.1. [O43521-1]
CCDS2092.1. [O43521-17]
CCDS42731.1. [O43521-2]
CCDS56131.1. [O43521-16]
CCDS56132.1. [O43521-7]
CCDS56133.1. [O43521-9]
CCDS56134.1. [O43521-10]
CCDS56135.1. [O43521-8]
CCDS56136.1. [O43521-14]
CCDS74560.1. [O43521-4]
CCDS74561.1. [O43521-11]
RefSeqiNP_001191035.1. NM_001204106.1. [O43521-3]
NP_001191036.1. NM_001204107.1. [O43521-7]
NP_001191037.1. NM_001204108.1. [O43521-8]
NP_001191038.1. NM_001204109.1. [O43521-14]
NP_001191039.1. NM_001204110.1. [O43521-9]
NP_001191040.1. NM_001204111.1. [O43521-15]
NP_001191041.1. NM_001204112.1. [O43521-16]
NP_001191042.1. NM_001204113.1.
NP_006529.1. NM_006538.4. [O43521-2]
NP_619527.1. NM_138621.4. [O43521-1]
NP_619528.1. NM_138622.3. [O43521-4]
NP_619529.1. NM_138623.3. [O43521-5]
NP_619530.1. NM_138624.3. [O43521-10]
NP_619531.1. NM_138625.3.
NP_619532.1. NM_138626.3. [O43521-11]
NP_619533.1. NM_138627.3.
NP_996885.1. NM_207002.3. [O43521-17]
NP_996886.1. NM_207003.2. [O43521-6]
UniGeneiHs.469658.
Hs.737004.

Genome annotation databases

EnsembliENST00000308659; ENSP00000309226; ENSG00000153094. [O43521-2]
ENST00000337565; ENSP00000338374; ENSG00000153094. [O43521-17]
ENST00000393256; ENSP00000376943; ENSG00000153094. [O43521-1]
ENST00000405953; ENSP00000384641; ENSG00000153094. [O43521-17]
ENST00000415458; ENSP00000393781; ENSG00000153094. [O43521-16]
ENST00000431217; ENSP00000394640; ENSG00000153094. [O43521-10]
ENST00000433098; ENSP00000401662; ENSG00000153094. [O43521-5]
ENST00000436733; ENSP00000403727; ENSG00000153094. [O43521-14]
ENST00000437029; ENSP00000412892; ENSG00000153094. [O43521-8]
ENST00000439718; ENSP00000411137; ENSG00000153094. [O43521-7]
ENST00000452231; ENSP00000391292; ENSG00000153094. [O43521-9]
ENST00000610735; ENSP00000481030; ENSG00000153094. [O43521-14]
ENST00000615946; ENSP00000481423; ENSG00000153094. [O43521-7]
ENST00000619294; ENSP00000479714; ENSG00000153094. [O43521-10]
ENST00000620862; ENSP00000478133; ENSG00000153094. [O43521-5]
ENST00000621302; ENSP00000481652; ENSG00000153094. [O43521-4]
ENST00000622509; ENSP00000482175; ENSG00000153094. [O43521-8]
ENST00000622612; ENSP00000484360; ENSG00000153094. [O43521-11]
GeneIDi10018.
KEGGihsa:10018.
UCSCiuc002tgt.2. human. [O43521-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF032457 mRNA. Translation: AAC39593.1.
AF032458 mRNA. Translation: AAC39594.1.
AB071195 mRNA. Translation: BAB78589.1.
AB071196 mRNA. Translation: BAB78590.1.
AB071197 mRNA. Translation: BAB78591.1.
AB071198 mRNA. Translation: BAB78592.1.
AB071199 mRNA. Translation: BAB78593.1.
AB071200 mRNA. Translation: BAB78594.1.
AY352518 mRNA. Translation: AAQ62569.1.
AY305714 mRNA. Translation: AAQ82546.1.
AY305715 mRNA. Translation: AAQ82547.1.
AY423441 mRNA. Translation: AAQ99148.1.
AY423442 mRNA. Translation: AAQ99149.1.
AY423443 mRNA. Translation: AAQ99150.1.
AY428962 mRNA. Translation: AAR06908.1.
DQ849200 mRNA. Translation: ABI13589.1.
DQ849201 mRNA. Translation: ABI13590.1.
DQ849202 mRNA. Translation: ABI13591.1.
AK290377 mRNA. Translation: BAF83066.1.
AK291269 mRNA. Translation: BAF83958.1.
AC096670 Genomic DNA. Translation: AAY14797.1.
CH471237 Genomic DNA. Translation: EAW50365.1.
CH471237 Genomic DNA. Translation: EAW50367.1.
CH471237 Genomic DNA. Translation: EAW50369.1.
CH471237 Genomic DNA. Translation: EAW50370.1.
CH471237 Genomic DNA. Translation: EAW50371.1.
CH471237 Genomic DNA. Translation: EAW50372.1.
CH471237 Genomic DNA. Translation: EAW50373.1.
CH471237 Genomic DNA. Translation: EAW50374.1.
BC033694 mRNA. Translation: AAH33694.1.
CCDSiCCDS2089.1. [O43521-1]
CCDS2092.1. [O43521-17]
CCDS42731.1. [O43521-2]
CCDS56131.1. [O43521-16]
CCDS56132.1. [O43521-7]
CCDS56133.1. [O43521-9]
CCDS56134.1. [O43521-10]
CCDS56135.1. [O43521-8]
CCDS56136.1. [O43521-14]
CCDS74560.1. [O43521-4]
CCDS74561.1. [O43521-11]
RefSeqiNP_001191035.1. NM_001204106.1. [O43521-3]
NP_001191036.1. NM_001204107.1. [O43521-7]
NP_001191037.1. NM_001204108.1. [O43521-8]
NP_001191038.1. NM_001204109.1. [O43521-14]
NP_001191039.1. NM_001204110.1. [O43521-9]
NP_001191040.1. NM_001204111.1. [O43521-15]
NP_001191041.1. NM_001204112.1. [O43521-16]
NP_001191042.1. NM_001204113.1.
NP_006529.1. NM_006538.4. [O43521-2]
NP_619527.1. NM_138621.4. [O43521-1]
NP_619528.1. NM_138622.3. [O43521-4]
NP_619529.1. NM_138623.3. [O43521-5]
NP_619530.1. NM_138624.3. [O43521-10]
NP_619531.1. NM_138625.3.
NP_619532.1. NM_138626.3. [O43521-11]
NP_619533.1. NM_138627.3.
NP_996885.1. NM_207002.3. [O43521-17]
NP_996886.1. NM_207003.2. [O43521-6]
UniGeneiHs.469658.
Hs.737004.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F95NMR-C/D108-116[»]
2K7WNMR-B145-164[»]
2NL9X-ray1.55B141-166[»]
2V6QX-ray2.70B141-166[»]
2VM6X-ray2.20B141-165[»]
2WH6X-ray1.50B141-166[»]
2YQ6X-ray1.80B147-164[»]
2YQ7X-ray1.90B147-164[»]
3D7VX-ray2.03B141-166[»]
3FDLX-ray1.78B141-166[»]
3IO8X-ray2.30B/D141-166[»]
3IO9X-ray2.40B141-166[»]
3KJ0X-ray1.70B143-165[»]
3KJ1X-ray1.94B143-163[»]
3KJ2X-ray2.35B143-163[»]
4A1UX-ray1.54B146-163[»]
4A1WX-ray2.50P/Q/R/S146-163[»]
4B4SX-ray1.90B141-166[»]
4D2MX-ray2.10B/D141-166[»]
4QVFX-ray1.53B141-166[»]
4UF3X-ray2.70B141-166[»]
4YJ4X-ray2.10B146-165[»]
4ZIEX-ray1.80C141-166[»]
4ZIFX-ray2.40B141-160[»]
4ZIHX-ray2.50B141-160[»]
5AGWX-ray2.69C/D146-166[»]
5AGXX-ray2.24C/D146-166[»]
5C3GX-ray2.45B146-166[»]
DisProtiDP00643.
ProteinModelPortaliO43521.
SMRiO43521.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115335. 54 interactors.
DIPiDIP-29185N.
IntActiO43521. 32 interactors.
MINTiMINT-1664421.
STRINGi9606.ENSP00000376943.

Chemistry databases

BindingDBiO43521.
ChEMBLiCHEMBL5777.

Protein family/group databases

TCDBi8.A.69.1.1. the pro-apoptotic bcl-2-family protein bim (bim) family.

PTM databases

iPTMnetiO43521.
PhosphoSitePlusiO43521.

Polymorphism and mutation databases

BioMutaiBCL2L11.

Proteomic databases

MaxQBiO43521.
PaxDbiO43521.
PeptideAtlasiO43521.
PRIDEiO43521.

Protocols and materials databases

DNASUi10018.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000308659; ENSP00000309226; ENSG00000153094. [O43521-2]
ENST00000337565; ENSP00000338374; ENSG00000153094. [O43521-17]
ENST00000393256; ENSP00000376943; ENSG00000153094. [O43521-1]
ENST00000405953; ENSP00000384641; ENSG00000153094. [O43521-17]
ENST00000415458; ENSP00000393781; ENSG00000153094. [O43521-16]
ENST00000431217; ENSP00000394640; ENSG00000153094. [O43521-10]
ENST00000433098; ENSP00000401662; ENSG00000153094. [O43521-5]
ENST00000436733; ENSP00000403727; ENSG00000153094. [O43521-14]
ENST00000437029; ENSP00000412892; ENSG00000153094. [O43521-8]
ENST00000439718; ENSP00000411137; ENSG00000153094. [O43521-7]
ENST00000452231; ENSP00000391292; ENSG00000153094. [O43521-9]
ENST00000610735; ENSP00000481030; ENSG00000153094. [O43521-14]
ENST00000615946; ENSP00000481423; ENSG00000153094. [O43521-7]
ENST00000619294; ENSP00000479714; ENSG00000153094. [O43521-10]
ENST00000620862; ENSP00000478133; ENSG00000153094. [O43521-5]
ENST00000621302; ENSP00000481652; ENSG00000153094. [O43521-4]
ENST00000622509; ENSP00000482175; ENSG00000153094. [O43521-8]
ENST00000622612; ENSP00000484360; ENSG00000153094. [O43521-11]
GeneIDi10018.
KEGGihsa:10018.
UCSCiuc002tgt.2. human. [O43521-1]

Organism-specific databases

CTDi10018.
DisGeNETi10018.
GeneCardsiBCL2L11.
HGNCiHGNC:994. BCL2L11.
HPAiCAB026332.
MIMi603827. gene.
neXtProtiNX_O43521.
OpenTargetsiENSG00000153094.
PharmGKBiPA25305.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IZKS. Eukaryota.
ENOG410Y8GB. LUCA.
GeneTreeiENSGT00390000003178.
InParanoidiO43521.
KOiK16341.
OMAiAEDHPQM.
OrthoDBiEOG091G0XD3.
PhylomeDBiO43521.
TreeFamiTF335898.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000153094-MONOMER.
ReactomeiR-HSA-111446. Activation of BIM and translocation to mitochondria.
R-HSA-111453. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.
R-HSA-193648. NRAGE signals death through JNK.
R-HSA-6802952. Signaling by BRAF and RAF fusions.
SIGNORiO43521.

Miscellaneous databases

ChiTaRSiBCL2L11. human.
EvolutionaryTraceiO43521.
GeneWikiiBCL2L11.
GenomeRNAii10018.
PMAP-CutDBO43521.
PROiO43521.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000153094.
ExpressionAtlasiO43521. baseline and differential.
GenevisibleiO43521. HS.

Family and domain databases

InterProiIPR014771. Apoptosis_Bim_N.
IPR017288. Bcl-2-like_11.
IPR015040. Bcl-x_interacting_BH3_dom.
[Graphical view]
PfamiPF08945. Bclx_interact. 1 hit.
PF06773. Bim_N. 1 hit.
[Graphical view]
PIRSFiPIRSF037827. Bcl-2-like_p11. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiB2L11_HUMAN
AccessioniPrimary (citable) accession number: O43521
Secondary accession number(s): A8K2W2
, O43522, Q0MSE7, Q0MSE8, Q0MSE9, Q53R28, Q6JTU6, Q6T851, Q6TE14, Q6TE15, Q6TE16, Q6V402, Q8WYL6, Q8WYL7, Q8WYL8, Q8WYL9, Q8WYM0, Q8WYM1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: June 1, 1998
Last modified: November 30, 2016
This is version 164 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.