Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O43521

- B2L11_HUMAN

UniProt

O43521 - B2L11_HUMAN

Protein

Bcl-2-like protein 11

Gene

BCL2L11

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 140 (01 Oct 2014)
      Sequence version 1 (01 Jun 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.3 Publications

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. activation of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
    2. apoptotic process Source: UniProtKB
    3. apoptotic process involved in embryonic digit morphogenesis Source: Ensembl
    4. apoptotic signaling pathway Source: Reactome
    5. B cell apoptotic process Source: Ensembl
    6. B cell homeostasis Source: Ensembl
    7. brain development Source: Ensembl
    8. cell-matrix adhesion Source: Ensembl
    9. cellular process regulating host cell cycle in response to virus Source: Ensembl
    10. developmental pigmentation Source: Ensembl
    11. ear development Source: Ensembl
    12. extrinsic apoptotic signaling pathway in absence of ligand Source: Ensembl
    13. intrinsic apoptotic signaling pathway Source: Reactome
    14. intrinsic apoptotic signaling pathway in response to DNA damage Source: MGI
    15. in utero embryonic development Source: Ensembl
    16. kidney development Source: Ensembl
    17. male gonad development Source: Ensembl
    18. mammary gland development Source: Ensembl
    19. myeloid cell homeostasis Source: Ensembl
    20. neurotrophin TRK receptor signaling pathway Source: Reactome
    21. odontogenesis of dentin-containing tooth Source: Ensembl
    22. positive regulation of apoptotic process Source: UniProtKB
    23. positive regulation of apoptotic process by virus Source: Ensembl
    24. positive regulation of cell cycle Source: Ensembl
    25. positive regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: Ensembl
    26. positive regulation of fibroblast apoptotic process Source: UniProtKB
    27. positive regulation of intrinsic apoptotic signaling pathway Source: UniProtKB
    28. positive regulation of mitochondrial membrane permeability involved in apoptotic process Source: Ensembl
    29. positive regulation of neuron apoptotic process Source: Ensembl
    30. positive regulation of protein homooligomerization Source: BHF-UCL
    31. positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway Source: Reactome
    32. positive regulation of release of cytochrome c from mitochondria Source: UniProtKB
    33. post-embryonic organ morphogenesis Source: Ensembl
    34. regulation of developmental pigmentation Source: Ensembl
    35. regulation of organ growth Source: Ensembl
    36. response to endoplasmic reticulum stress Source: UniProtKB
    37. spermatogenesis Source: Ensembl
    38. spleen development Source: Ensembl
    39. T cell homeostasis Source: Ensembl
    40. thymocyte apoptotic process Source: Ensembl
    41. thymus development Source: Ensembl
    42. tube formation Source: Ensembl

    Keywords - Biological processi

    Apoptosis

    Enzyme and pathway databases

    ReactomeiREACT_13638. NRAGE signals death through JNK.
    REACT_330. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Bcl-2-like protein 11
    Short name:
    Bcl2-L-11
    Alternative name(s):
    Bcl2-interacting mediator of cell death
    Gene namesi
    Name:BCL2L11
    Synonyms:BIM
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:994. BCL2L11.

    Subcellular locationi

    Endomembrane system By similarity; Peripheral membrane protein By similarity
    Note: Associated with intracytoplasmic membranes.By similarity
    Isoform BimEL : Mitochondrion
    Note: Translocates from microtubules to motochondria on loss of cell adherence.

    GO - Cellular componenti

    1. BIM-BCL-2 complex Source: UniProtKB
    2. BIM-BCL-xl complex Source: UniProtKB
    3. cytosol Source: UniProtKB
    4. endomembrane system Source: UniProtKB-SubCell
    5. extrinsic component of membrane Source: Ensembl
    6. mitochondrial outer membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane, Mitochondrion

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi156 – 1561G → A: Retains the ability to induce apoptosis. Abolishes interaction with BAX; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BCL2. 2 Publications
    Mutagenesisi156 – 1561G → E: Abolishes induction of apoptosis. Abolishes interaction with BAX and BCL2; in isoform Bim-alpha3 and isoform BimS. Loses the ability to induce the conformationally active form of BAX. 2 Publications
    Mutagenesisi160 – 1601N → A: Retains the ability to induce apoptosis. Abolishes interaction with BCL2; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BAX. 1 Publication

    Organism-specific databases

    PharmGKBiPA25305.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 198198Bcl-2-like protein 11PRO_0000143109Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei69 – 691Phosphoserine; by MAPK1 Publication

    Post-translational modificationi

    Phosphorylation at Ser-69 by MAPK1/MAPK3 induces interaction with TRIM2, followed by polyubiquitination.1 Publication
    Ubiquitinated by TRIM2 following phosphorylation by MAPK1/MAPK3, leading to degradation by the proteasome.By similarity

    Keywords - PTMi

    Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiO43521.
    PaxDbiO43521.
    PRIDEiO43521.

    PTM databases

    PhosphoSiteiO43521.

    Miscellaneous databases

    PMAP-CutDBO43521.

    Expressioni

    Tissue specificityi

    Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are ubiquitously expressed with a tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney.1 Publication

    Inductioni

    By ER stress in a DDIT3/CHOP-dependent manner.1 Publication

    Gene expression databases

    ArrayExpressiO43521.
    BgeeiO43521.
    GenevestigatoriO43521.

    Organism-specific databases

    HPAiCAB026332.

    Interactioni

    Subunit structurei

    Forms heterodimers with a number of antiapoptotic Bcl-2 proteins including MCL1, BCL2, BCL2L1 isoform Bcl-X(L), BCL2A1/BFL-1, BHRF1, and BCLW. Isoform BimS and isoform Bim-alpha3 interact with BAX; this interaction induces the conformationally active form of BAX. Does not heterodimerize with proapoptotic proteins such as BAD, BOK or BAK. Interacts with DYNLL1 and YWHAZ. When phosphorylated, interacts with TRIM2; this interaction is associated with ubiquitination and degradation. Interacts with MCL1; may sequester BCL2L11 to prevent its pro-apoptotic activity.4 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    BADQ929342EBI-526406,EBI-700771
    BAXQ0781219EBI-526406,EBI-516580
    BCL2P104157EBI-526406,EBI-77694
    Bcl2a1Q074402EBI-526406,EBI-707754From a different organism.
    BCL2L1Q078172EBI-526406,EBI-78035
    BCL2L1Q07817-110EBI-526406,EBI-287195
    BCL2L2Q928434EBI-526406,EBI-707714
    F1LP684514EBI-526406,EBI-7066119From a different organism.
    GNB2L1P632442EBI-526406,EBI-296739
    MCL1Q0782011EBI-526406,EBI-1003422
    Mcl1P972877EBI-526406,EBI-707292From a different organism.
    MIFP141745EBI-526420,EBI-372712
    NSP034952EBI-526406,EBI-2548993From a different organism.

    Protein-protein interaction databases

    BioGridi115335. 38 interactions.
    DIPiDIP-29185N.
    IntActiO43521. 28 interactions.
    MINTiMINT-1664421.

    Structurei

    Secondary structure

    1
    198
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi112 – 1154
    Helixi143 – 15917

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1F95NMR-C/D108-116[»]
    2K7WNMR-B145-164[»]
    2NL9X-ray1.55B141-166[»]
    2V6QX-ray2.70B141-166[»]
    2VM6X-ray2.20B141-165[»]
    2WH6X-ray1.50B141-166[»]
    2YQ6X-ray1.80B147-164[»]
    3D7VX-ray2.03B141-166[»]
    3FDLX-ray1.78B141-166[»]
    3IO8X-ray2.30B/D141-166[»]
    3IO9X-ray2.40B141-166[»]
    3KJ0X-ray1.70B143-165[»]
    3KJ1X-ray1.94B143-163[»]
    3KJ2X-ray2.35B143-163[»]
    4B4SX-ray1.90B141-166[»]
    4D2MX-ray2.10B/D141-166[»]
    DisProtiDP00643.
    ProteinModelPortaliO43521.
    SMRiO43521. Positions 141-173.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO43521.

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi148 – 16215BH3Add
    BLAST

    Domaini

    The BH3 motif is required for Bcl-2 binding and cytotoxicity.

    Sequence similaritiesi

    Belongs to the Bcl-2 family.Curated

    Phylogenomic databases

    eggNOGiNOG40262.
    InParanoidiO43521.
    KOiK16341.
    OMAiEMPITSH.
    PhylomeDBiO43521.
    TreeFamiTF335898.

    Family and domain databases

    InterProiIPR014771. Apoptosis_Bim_N.
    IPR017288. Bcl-2-like_11.
    IPR015040. Bcl-x_interacting_BH3_dom.
    [Graphical view]
    PfamiPF08945. Bclx_interact. 1 hit.
    PF06773. Bim_N. 1 hit.
    [Graphical view]
    PIRSFiPIRSF037827. Bcl-2-like_p11. 1 hit.

    Sequences (20)i

    Sequence statusi: Complete.

    This entry describes 20 isoformsi produced by alternative splicing. Align

    Isoform BimEL (identifier: O43521-1) [UniParc]FASTAAdd to Basket

    Also known as: Bim(EL)

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAKQPSDVSS ECDREGRQLQ PAERPPQLRP GAPTSLQTEP QGNPEGNHGG    50
    EGDSCPHGSP QGPLAPPASP GPFATRSPLF IFMRRSSLLS RSSSGYFSFD 100
    TDRSPAPMSC DKSTQTPSPP CQAFNHYLSA MASMRQAEPA DMRPEIWIAQ 150
    ELRRIGDEFN AYYARRVFLN NYQAAEDHPR MVILRLLRYI VRLVWRMH 198
    Length:198
    Mass (Da):22,171
    Last modified:June 1, 1998 - v1
    Checksum:iD75735E469CA6997
    GO
    Isoform BimL (identifier: O43521-2) [UniParc]FASTAAdd to Basket

    Also known as: Bim(L)

    The sequence of this isoform differs from the canonical sequence as follows:
         42-101: Missing.

    Show »
    Length:138
    Mass (Da):15,967
    Checksum:i8BB4AAE06CB080FA
    GO
    Isoform BimS (identifier: O43521-3) [UniParc]FASTAAdd to Basket

    Also known as: BCL2-like 11 transcript variant 9, Bim(S)

    The sequence of this isoform differs from the canonical sequence as follows:
         42-131: Missing.

    Show »
    Length:108
    Mass (Da):12,717
    Checksum:i60067208524D5BEA
    GO
    Isoform Bim-alpha1 (identifier: O43521-4) [UniParc]FASTAAdd to Basket

    Also known as: BimABCD, Bim-ABCD

    The sequence of this isoform differs from the canonical sequence as follows:
         167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

    Show »
    Length:169
    Mass (Da):18,536
    Checksum:iE2E24D5697C955BA
    GO
    Isoform Bim-alpha2 (identifier: O43521-5) [UniParc]FASTAAdd to Basket

    Also known as: BimACD, Bim-ACD

    The sequence of this isoform differs from the canonical sequence as follows:
         42-101: Missing.
         167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

    Show »
    Length:109
    Mass (Da):12,332
    Checksum:i4335FA21C13B49AD
    GO
    Isoform Bim-alpha3 (identifier: O43521-6) [UniParc]FASTAAdd to Basket

    Also known as: BCL2-like 11 transcript variant 10, BimAD, Bim-AD

    The sequence of this isoform differs from the canonical sequence as follows:
         42-131: Missing.
         167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

    Show »
    Length:79
    Mass (Da):9,081
    Checksum:i3E03CCF2154A242C
    GO
    Isoform Bim-alpha4 (identifier: O43521-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         42-131: Missing.
         167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LAKLLASST

    Show »
    Length:85
    Mass (Da):9,596
    Checksum:i7A6FD9AF07DA3E05
    GO
    Isoform Bim-alpha5 (identifier: O43521-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD

    Show »
    Length:172
    Mass (Da):18,816
    Checksum:iD2F7FC06EE3CE697
    GO
    Isoform Bim-alpha6 (identifier: O43521-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         42-131: Missing.
         167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD

    Show »
    Length:82
    Mass (Da):9,362
    Checksum:i08678A7A0FBD4215
    GO
    Isoform Bim-beta1 (identifier: O43521-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         133-135: SMR → NWD
         136-198: Missing.

    Show »
    Length:135
    Mass (Da):14,458
    Checksum:iD208F1CB6D324539
    GO
    Isoform Bim-beta2 (identifier: O43521-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         132-135: ASMR → GIFE
         136-198: Missing.

    Show »
    Length:135
    Mass (Da):14,418
    Checksum:iD3A245DECD324539
    GO
    Isoform Bim-beta3 (identifier: O43521-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         42-75: GNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFAT → VSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK

    Show »
    Length:198
    Mass (Da):22,649
    Checksum:iA8FA866EBD5CF16E
    GO
    Isoform Bim-beta4 (identifier: O43521-13) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         43-44: NP → IF
         45-198: Missing.

    Show »
    Length:44
    Mass (Da):4,834
    Checksum:iFA9541901CA32FD1
    GO
    Isoform Bim-beta5 (identifier: O43521-14) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         132-140: ASMRQAEPA → VREIEEVVV
         141-198: Missing.

    Show »
    Length:140
    Mass (Da):15,025
    Checksum:iB7590CC04A98E081
    GO
    Isoform Bim-beta6 (identifier: O43521-15) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         42-101: Missing.
         132-135: ASMR → GIFE
         136-198: Missing.

    Show »
    Length:75
    Mass (Da):8,214
    Checksum:i7CFE6B5A5ED671F3
    GO
    Isoform Bim-beta7 (identifier: O43521-16) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         42-101: Missing.
         132-140: ASMRQAEPA → VREIEEVVV
         141-198: Missing.

    Show »
    Length:80
    Mass (Da):8,821
    Checksum:i6958582B30D7BCAF
    GO
    Isoform Bim-gamma (identifier: O43521-17) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         42-101: Missing.
         132-198: ASMRQAEPAD...YIVRLVWRMH → VVILEDIGDL...TEQLNHKDFS

    Show »
    Length:112
    Mass (Da):12,412
    Checksum:i15E21254C12C239B
    GO
    Isoform BimABC (identifier: O43521-18) [UniParc]FASTAAdd to Basket

    Also known as: Bim-ABC

    The sequence of this isoform differs from the canonical sequence as follows:
         42-101: Missing.
         132-166: Missing.

    Show »
    Length:103
    Mass (Da):11,773
    Checksum:iFD4F4A9292591961
    GO
    Isoform BimAC (identifier: O43521-19) [UniParc]FASTAAdd to Basket

    Also known as: Bim-AC

    The sequence of this isoform differs from the canonical sequence as follows:
         132-166: Missing.

    Show »
    Length:163
    Mass (Da):17,977
    Checksum:i215890B3975C25A5
    GO
    Isoform BimA (identifier: O43521-20) [UniParc]FASTAAdd to Basket

    Also known as: Bim-A

    The sequence of this isoform differs from the canonical sequence as follows:
         42-166: Missing.

    Show »
    Length:73
    Mass (Da):8,523
    Checksum:iD0CE170469B8570D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti33 – 331P → L in BAF83066. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei42 – 166125Missing in isoform BimA. 1 PublicationVSP_042865Add
    BLAST
    Alternative sequencei42 – 13190Missing in isoform BimS, isoform Bim-alpha3, isoform Bim-alpha6 and isoform Bim-alpha4. 3 PublicationsVSP_035608Add
    BLAST
    Alternative sequencei42 – 10160Missing in isoform BimABC, isoform BimL, isoform Bim-alpha2, isoform Bim-gamma, isoform Bim-beta6 and isoform Bim-beta7. 6 PublicationsVSP_000535Add
    BLAST
    Alternative sequencei42 – 7534GNPEG…GPFAT → VSLCHPGWSALVRSWLTATS NSQVQAVLLPQPPK in isoform Bim-beta3. 1 PublicationVSP_035609Add
    BLAST
    Alternative sequencei43 – 442NP → IF in isoform Bim-beta4. 1 PublicationVSP_035610
    Alternative sequencei45 – 198154Missing in isoform Bim-beta4. 1 PublicationVSP_035611Add
    BLAST
    Alternative sequencei132 – 19867ASMRQ…VWRMH → VVILEDIGDLSLCFGFIFTG LDLYGHHHSQDTEQLNHKDF S in isoform Bim-gamma. 1 PublicationVSP_035612Add
    BLAST
    Alternative sequencei132 – 16635Missing in isoform BimAC and isoform BimABC. 1 PublicationVSP_042866Add
    BLAST
    Alternative sequencei132 – 1409ASMRQAEPA → VREIEEVVV in isoform Bim-beta5 and isoform Bim-beta7. 1 PublicationVSP_035613
    Alternative sequencei132 – 1354ASMR → GIFE in isoform Bim-beta2 and isoform Bim-beta6. 2 PublicationsVSP_035614
    Alternative sequencei133 – 1353SMR → NWD in isoform Bim-beta1. 1 PublicationVSP_035615
    Alternative sequencei136 – 19863Missing in isoform Bim-beta1, isoform Bim-beta2 and isoform Bim-beta6. 2 PublicationsVSP_035616Add
    BLAST
    Alternative sequencei141 – 19858Missing in isoform Bim-beta5 and isoform Bim-beta7. 1 PublicationVSP_035617Add
    BLAST
    Alternative sequencei167 – 19832VFLNN…VWRMH → LEK in isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3. 4 PublicationsVSP_035620Add
    BLAST
    Alternative sequencei167 – 19832VFLNN…VWRMH → LAKLLASST in isoform Bim-alpha4. 1 PublicationVSP_035618Add
    BLAST
    Alternative sequencei167 – 19832VFLNN…VWRMH → MPLPPD in isoform Bim-alpha5 and isoform Bim-alpha6. 1 PublicationVSP_035619Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF032457 mRNA. Translation: AAC39593.1.
    AF032458 mRNA. Translation: AAC39594.1.
    AB071195 mRNA. Translation: BAB78589.1.
    AB071196 mRNA. Translation: BAB78590.1.
    AB071197 mRNA. Translation: BAB78591.1.
    AB071198 mRNA. Translation: BAB78592.1.
    AB071199 mRNA. Translation: BAB78593.1.
    AB071200 mRNA. Translation: BAB78594.1.
    AY352518 mRNA. Translation: AAQ62569.1.
    AY305714 mRNA. Translation: AAQ82546.1.
    AY305715 mRNA. Translation: AAQ82547.1.
    AY423441 mRNA. Translation: AAQ99148.1.
    AY423442 mRNA. Translation: AAQ99149.1.
    AY423443 mRNA. Translation: AAQ99150.1.
    AY428962 mRNA. Translation: AAR06908.1.
    DQ849200 mRNA. Translation: ABI13589.1.
    DQ849201 mRNA. Translation: ABI13590.1.
    DQ849202 mRNA. Translation: ABI13591.1.
    AK290377 mRNA. Translation: BAF83066.1.
    AK291269 mRNA. Translation: BAF83958.1.
    AC096670 Genomic DNA. Translation: AAY14797.1.
    CH471237 Genomic DNA. Translation: EAW50365.1.
    CH471237 Genomic DNA. Translation: EAW50367.1.
    CH471237 Genomic DNA. Translation: EAW50369.1.
    CH471237 Genomic DNA. Translation: EAW50370.1.
    CH471237 Genomic DNA. Translation: EAW50371.1.
    CH471237 Genomic DNA. Translation: EAW50372.1.
    CH471237 Genomic DNA. Translation: EAW50373.1.
    CH471237 Genomic DNA. Translation: EAW50374.1.
    BC033694 mRNA. Translation: AAH33694.1.
    CCDSiCCDS2089.1. [O43521-1]
    CCDS2092.1. [O43521-17]
    CCDS42731.1. [O43521-2]
    CCDS56131.1. [O43521-16]
    CCDS56132.1. [O43521-7]
    CCDS56133.1. [O43521-9]
    CCDS56134.1. [O43521-10]
    CCDS56135.1. [O43521-8]
    CCDS56136.1. [O43521-14]
    RefSeqiNP_001191035.1. NM_001204106.1. [O43521-3]
    NP_001191036.1. NM_001204107.1. [O43521-7]
    NP_001191037.1. NM_001204108.1. [O43521-8]
    NP_001191038.1. NM_001204109.1. [O43521-14]
    NP_001191039.1. NM_001204110.1. [O43521-9]
    NP_001191040.1. NM_001204111.1. [O43521-15]
    NP_001191041.1. NM_001204112.1. [O43521-16]
    NP_001191042.1. NM_001204113.1.
    NP_006529.1. NM_006538.4. [O43521-2]
    NP_619527.1. NM_138621.4. [O43521-1]
    NP_619528.1. NM_138622.3. [O43521-4]
    NP_619529.1. NM_138623.3. [O43521-5]
    NP_619530.1. NM_138624.3. [O43521-10]
    NP_619531.1. NM_138625.3.
    NP_619532.1. NM_138626.3. [O43521-11]
    NP_619533.1. NM_138627.3.
    NP_996885.1. NM_207002.3. [O43521-17]
    NP_996886.1. NM_207003.2. [O43521-6]
    UniGeneiHs.469658.
    Hs.737004.

    Genome annotation databases

    EnsembliENST00000308659; ENSP00000309226; ENSG00000153094. [O43521-2]
    ENST00000337565; ENSP00000338374; ENSG00000153094. [O43521-17]
    ENST00000357757; ENSP00000350398; ENSG00000153094. [O43521-8]
    ENST00000361493; ENSP00000354879; ENSG00000153094.
    ENST00000393256; ENSP00000376943; ENSG00000153094. [O43521-1]
    ENST00000405953; ENSP00000384641; ENSG00000153094. [O43521-17]
    ENST00000415458; ENSP00000393781; ENSG00000153094. [O43521-16]
    ENST00000431217; ENSP00000394640; ENSG00000153094. [O43521-10]
    ENST00000433098; ENSP00000401662; ENSG00000153094. [O43521-5]
    ENST00000436733; ENSP00000403727; ENSG00000153094. [O43521-14]
    ENST00000437029; ENSP00000412892; ENSG00000153094. [O43521-8]
    ENST00000439718; ENSP00000411137; ENSG00000153094. [O43521-7]
    ENST00000452231; ENSP00000391292; ENSG00000153094. [O43521-9]
    GeneIDi10018.
    KEGGihsa:10018.
    UCSCiuc002tgt.1. human. [O43521-17]
    uc002tgu.1. human. [O43521-2]
    uc002tgv.1. human. [O43521-1]
    uc002tgw.2. human. [O43521-6]
    uc002tgx.2. human. [O43521-9]
    uc002tgy.2. human. [O43521-16]
    uc002tgz.2. human. [O43521-3]
    uc002tha.2. human. [O43521-11]
    uc002thb.2. human. [O43521-5]
    uc002thc.2. human. [O43521-7]
    uc002thd.2. human. [O43521-15]
    uc010fkd.2. human. [O43521-13]
    uc021vmp.1. human. [O43521-14]
    uc021vmq.1. human. [O43521-4]
    uc021vmr.1. human. [O43521-10]
    uc021vms.1. human. [O43521-8]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF032457 mRNA. Translation: AAC39593.1 .
    AF032458 mRNA. Translation: AAC39594.1 .
    AB071195 mRNA. Translation: BAB78589.1 .
    AB071196 mRNA. Translation: BAB78590.1 .
    AB071197 mRNA. Translation: BAB78591.1 .
    AB071198 mRNA. Translation: BAB78592.1 .
    AB071199 mRNA. Translation: BAB78593.1 .
    AB071200 mRNA. Translation: BAB78594.1 .
    AY352518 mRNA. Translation: AAQ62569.1 .
    AY305714 mRNA. Translation: AAQ82546.1 .
    AY305715 mRNA. Translation: AAQ82547.1 .
    AY423441 mRNA. Translation: AAQ99148.1 .
    AY423442 mRNA. Translation: AAQ99149.1 .
    AY423443 mRNA. Translation: AAQ99150.1 .
    AY428962 mRNA. Translation: AAR06908.1 .
    DQ849200 mRNA. Translation: ABI13589.1 .
    DQ849201 mRNA. Translation: ABI13590.1 .
    DQ849202 mRNA. Translation: ABI13591.1 .
    AK290377 mRNA. Translation: BAF83066.1 .
    AK291269 mRNA. Translation: BAF83958.1 .
    AC096670 Genomic DNA. Translation: AAY14797.1 .
    CH471237 Genomic DNA. Translation: EAW50365.1 .
    CH471237 Genomic DNA. Translation: EAW50367.1 .
    CH471237 Genomic DNA. Translation: EAW50369.1 .
    CH471237 Genomic DNA. Translation: EAW50370.1 .
    CH471237 Genomic DNA. Translation: EAW50371.1 .
    CH471237 Genomic DNA. Translation: EAW50372.1 .
    CH471237 Genomic DNA. Translation: EAW50373.1 .
    CH471237 Genomic DNA. Translation: EAW50374.1 .
    BC033694 mRNA. Translation: AAH33694.1 .
    CCDSi CCDS2089.1. [O43521-1 ]
    CCDS2092.1. [O43521-17 ]
    CCDS42731.1. [O43521-2 ]
    CCDS56131.1. [O43521-16 ]
    CCDS56132.1. [O43521-7 ]
    CCDS56133.1. [O43521-9 ]
    CCDS56134.1. [O43521-10 ]
    CCDS56135.1. [O43521-8 ]
    CCDS56136.1. [O43521-14 ]
    RefSeqi NP_001191035.1. NM_001204106.1. [O43521-3 ]
    NP_001191036.1. NM_001204107.1. [O43521-7 ]
    NP_001191037.1. NM_001204108.1. [O43521-8 ]
    NP_001191038.1. NM_001204109.1. [O43521-14 ]
    NP_001191039.1. NM_001204110.1. [O43521-9 ]
    NP_001191040.1. NM_001204111.1. [O43521-15 ]
    NP_001191041.1. NM_001204112.1. [O43521-16 ]
    NP_001191042.1. NM_001204113.1.
    NP_006529.1. NM_006538.4. [O43521-2 ]
    NP_619527.1. NM_138621.4. [O43521-1 ]
    NP_619528.1. NM_138622.3. [O43521-4 ]
    NP_619529.1. NM_138623.3. [O43521-5 ]
    NP_619530.1. NM_138624.3. [O43521-10 ]
    NP_619531.1. NM_138625.3.
    NP_619532.1. NM_138626.3. [O43521-11 ]
    NP_619533.1. NM_138627.3.
    NP_996885.1. NM_207002.3. [O43521-17 ]
    NP_996886.1. NM_207003.2. [O43521-6 ]
    UniGenei Hs.469658.
    Hs.737004.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1F95 NMR - C/D 108-116 [» ]
    2K7W NMR - B 145-164 [» ]
    2NL9 X-ray 1.55 B 141-166 [» ]
    2V6Q X-ray 2.70 B 141-166 [» ]
    2VM6 X-ray 2.20 B 141-165 [» ]
    2WH6 X-ray 1.50 B 141-166 [» ]
    2YQ6 X-ray 1.80 B 147-164 [» ]
    3D7V X-ray 2.03 B 141-166 [» ]
    3FDL X-ray 1.78 B 141-166 [» ]
    3IO8 X-ray 2.30 B/D 141-166 [» ]
    3IO9 X-ray 2.40 B 141-166 [» ]
    3KJ0 X-ray 1.70 B 143-165 [» ]
    3KJ1 X-ray 1.94 B 143-163 [» ]
    3KJ2 X-ray 2.35 B 143-163 [» ]
    4B4S X-ray 1.90 B 141-166 [» ]
    4D2M X-ray 2.10 B/D 141-166 [» ]
    DisProti DP00643.
    ProteinModelPortali O43521.
    SMRi O43521. Positions 141-173.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115335. 38 interactions.
    DIPi DIP-29185N.
    IntActi O43521. 28 interactions.
    MINTi MINT-1664421.

    Chemistry

    BindingDBi O43521.
    ChEMBLi CHEMBL5777.

    PTM databases

    PhosphoSitei O43521.

    Proteomic databases

    MaxQBi O43521.
    PaxDbi O43521.
    PRIDEi O43521.

    Protocols and materials databases

    DNASUi 10018.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000308659 ; ENSP00000309226 ; ENSG00000153094 . [O43521-2 ]
    ENST00000337565 ; ENSP00000338374 ; ENSG00000153094 . [O43521-17 ]
    ENST00000357757 ; ENSP00000350398 ; ENSG00000153094 . [O43521-8 ]
    ENST00000361493 ; ENSP00000354879 ; ENSG00000153094 .
    ENST00000393256 ; ENSP00000376943 ; ENSG00000153094 . [O43521-1 ]
    ENST00000405953 ; ENSP00000384641 ; ENSG00000153094 . [O43521-17 ]
    ENST00000415458 ; ENSP00000393781 ; ENSG00000153094 . [O43521-16 ]
    ENST00000431217 ; ENSP00000394640 ; ENSG00000153094 . [O43521-10 ]
    ENST00000433098 ; ENSP00000401662 ; ENSG00000153094 . [O43521-5 ]
    ENST00000436733 ; ENSP00000403727 ; ENSG00000153094 . [O43521-14 ]
    ENST00000437029 ; ENSP00000412892 ; ENSG00000153094 . [O43521-8 ]
    ENST00000439718 ; ENSP00000411137 ; ENSG00000153094 . [O43521-7 ]
    ENST00000452231 ; ENSP00000391292 ; ENSG00000153094 . [O43521-9 ]
    GeneIDi 10018.
    KEGGi hsa:10018.
    UCSCi uc002tgt.1. human. [O43521-17 ]
    uc002tgu.1. human. [O43521-2 ]
    uc002tgv.1. human. [O43521-1 ]
    uc002tgw.2. human. [O43521-6 ]
    uc002tgx.2. human. [O43521-9 ]
    uc002tgy.2. human. [O43521-16 ]
    uc002tgz.2. human. [O43521-3 ]
    uc002tha.2. human. [O43521-11 ]
    uc002thb.2. human. [O43521-5 ]
    uc002thc.2. human. [O43521-7 ]
    uc002thd.2. human. [O43521-15 ]
    uc010fkd.2. human. [O43521-13 ]
    uc021vmp.1. human. [O43521-14 ]
    uc021vmq.1. human. [O43521-4 ]
    uc021vmr.1. human. [O43521-10 ]
    uc021vms.1. human. [O43521-8 ]

    Organism-specific databases

    CTDi 10018.
    GeneCardsi GC02P111876.
    HGNCi HGNC:994. BCL2L11.
    HPAi CAB026332.
    MIMi 603827. gene.
    neXtProti NX_O43521.
    PharmGKBi PA25305.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG40262.
    InParanoidi O43521.
    KOi K16341.
    OMAi EMPITSH.
    PhylomeDBi O43521.
    TreeFami TF335898.

    Enzyme and pathway databases

    Reactomei REACT_13638. NRAGE signals death through JNK.
    REACT_330. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.

    Miscellaneous databases

    ChiTaRSi BCL2L11. human.
    EvolutionaryTracei O43521.
    GeneWikii BCL2L11.
    GenomeRNAii 10018.
    NextBioi 37849.
    PMAP-CutDB O43521.
    PROi O43521.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O43521.
    Bgeei O43521.
    Genevestigatori O43521.

    Family and domain databases

    InterProi IPR014771. Apoptosis_Bim_N.
    IPR017288. Bcl-2-like_11.
    IPR015040. Bcl-x_interacting_BH3_dom.
    [Graphical view ]
    Pfami PF08945. Bclx_interact. 1 hit.
    PF06773. Bim_N. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF037827. Bcl-2-like_p11. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Bim: a novel member of the Bcl-2 family that promotes apoptosis."
      O'Connor L., Strasser A., O'Reilly L.A., Hausmann G., Adams J.M., Cory S., Huang D.C.S.
      EMBO J. 17:384-395(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMEL AND BIML), FUNCTION.
      Tissue: Peripheral blood and Spleen.
    2. "Molecular cloning and characterization of six novel isoforms of human Bim, a member of the proapoptotic Bcl-2 family."
      Mami U., Miyashita T., Shikama Y., Tadokoro K., Yamada M.
      FEBS Lett. 509:135-141(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIM-ALPHA1; BIM-ALPHA2; BIM-BETA1; BIM-BETA2; BIM-BETA3 AND BIM-BETA4), FUNCTION (ISOFORMS BIM-ALPHA1 AND BIM-ALPHA2), SUBCELLULAR LOCATION.
    3. "Identification and characterization of Bimgamma, a novel proapoptotic BH3-only splice variant of Bim."
      Liu J.-W., Chandra D., Tang S.H., Chopra D., Tang D.G.
      Cancer Res. 62:2976-2981(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BIM-GAMMA), FUNCTION (ISOFORM BIM-GAMMA), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    4. "Identification of novel isoforms of the BH3 domain protein Bim which directly activate Bax to trigger apoptosis."
      Marani M., Tenev T., Hancock D., Downward J., Lemoine N.R.
      Mol. Cell. Biol. 22:3577-3589(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMEL; BIML; BIMS; BIM-ALPHA1; BIM-ALPHA2; BIM-ALPHA3; BIMA; BIMABC AND BIMAC), ALTERNATIVE SPLICING, FUNCTION, SUBUNIT, MUTAGENESIS OF GLY-156 AND ASN-160.
      Tissue: Embryonic kidney and Ovarian cancer.
    5. "Over-expression of Bim alpha3, a novel isoform of human Bim, result in cell apoptosis."
      Chen J.Z., Ji C.N., Gu S.H., Li J.X., Zhao E.P., Huang Y., Huang L., Ying K., Xie Y., Mao Y.M.
      Int. J. Biochem. Cell Biol. 36:1554-1561(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIMS AND BIM-ALPHA3), FUNCTION (ISOFORM BIM-ALPHA3).
    6. "Identification and characterization of BH3 domain protein Bim and its isoforms in human hepatocellular carcinomas."
      Miao J., Chen G.G., Yun J.P., Chun S.Y., Zheng Z.Z., Ho R.L.K., Chak E.C., Xia N.S., Lai P.B.
      Apoptosis 12:1691-1701(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BIM-ALPHA3; BIM-ALPHA4; BIM-ALPHA5; BIM-ALPHA6; BIM-BETA5; BIM-BETA6; BIM-BETA7).
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS BIMEL AND BIML).
      Tissue: Teratocarcinoma and Tongue.
    8. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BIMEL).
      Tissue: Blood.
    11. "BimEL is an important determinant for induction of anoikis sensitivity by mitogen-activated protein/extracellular signal-regulated kinase kinase inhibitors."
      Fukazawa H., Noguchi K., Masumi A., Murakami Y., Uehara Y.
      Mol. Cancer Ther. 3:1281-1288(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-69, UBIQUITINATION.
    12. Cited for: MUTAGENESIS OF GLY-156.
    13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    14. "Identification of a novel Bcl-2-interacting mediator of cell death (Bim) E3 ligase, tripartite motif-containing protein 2 (TRIM2), and its role in rapid ischemic tolerance-induced neuroprotection."
      Thompson S., Pearson A.N., Ashley M.D., Jessick V., Murphy B.M., Gafken P., Henshall D.C., Morris K.T., Simon R.P., Meller R.
      J. Biol. Chem. 286:19331-19339(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TRIM2.
    15. "CHOP potentially co-operates with FOXO3a in neuronal cells to regulate PUMA and BIM expression in response to ER stress."
      Ghosh A.P., Klocke B.J., Ballestas M.E., Roth K.A.
      PLoS ONE 7:E39586-E39586(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION BY ER STRESS.
    16. Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 141-166 IN COMPLEX WITH MCL1.
    17. "Completing the family portrait of the anti-apoptotic Bcl-2 proteins: crystal structure of human Bfl-1 in complex with Bim."
      Herman M.D., Nyman T., Welin M., Lehtio L., Flodin S., Tresaugues L., Kotenyova T., Flores A., Nordlund P.
      FEBS Lett. 582:3590-3594(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 141-165 IN COMPLEX WITH BCL2A1.

    Entry informationi

    Entry nameiB2L11_HUMAN
    AccessioniPrimary (citable) accession number: O43521
    Secondary accession number(s): A8K2W2
    , O43522, Q0MSE7, Q0MSE8, Q0MSE9, Q53R28, Q6JTU6, Q6T851, Q6TE14, Q6TE15, Q6TE16, Q6V402, Q8WYL6, Q8WYL7, Q8WYL8, Q8WYL9, Q8WYM0, Q8WYM1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 18, 2001
    Last sequence update: June 1, 1998
    Last modified: October 1, 2014
    This is version 140 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3