Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O43497 (CAC1G_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Voltage-dependent T-type calcium channel subunit alpha-1G
Alternative name(s):
Cav3.1c
NBR13
Voltage-gated calcium channel subunit alpha Cav3.1
Gene names
Name:CACNA1G
Synonyms:KIAA1123
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2377 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1Ggives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by mibefradil. A particularity of this type of channel is an opening at quite negative potentials and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes.

Subcellular location

Membrane; Multi-pass membrane protein.

Tissue specificity

Highly expressed in brain, in particular in the amygdala, subthalamic nuclei, cerebellum and thalamus. Moderate expression in heart; low expression in placenta, kidney and lung. Also expressed in colon and bone marrow and in tumoral cells to a lesser extent. Highly expressed in fetal brain, but also in peripheral fetal tissues as heart, kidney and lung, suggesting a developmentally regulated expression.

Developmental stage

Isoform 4, isoform 7, isoform 18, isoform 19, isoform 24, isoform 25 and isoform 31 are adult-specific. Isoform 8, isoform 14, isoform 15, isoform 16, isoform 17, isoform 20, isoform 21, isoform 22, isoform 23, isoform 26, isoform 27, isoform 28, isoform 29 and isoform 30 are fetal-specific. Isoform 1, isoform 2, isoform 6, isoform 9, isoform 11, isoform 12 and isoform 13 are expressed in both fetus and adult. Ref.5

Domain

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

The linker region between repeat III and IV probably plays a role in the inactivation of the channel. The C-terminal part may be implicated in the anchoring of the protein to the membrane by interfering with or restricting its lateral diffusion.

Post-translational modification

In response to raising of intracellular calcium, the T-type channels are activated by CaM-kinase II.

Sequence similarities

Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. CACNA1G subfamily. [View classification]

Ontologies

Keywords
   Biological processCalcium transport
Ion transport
Transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainRepeat
Transmembrane
Transmembrane helix
   LigandCalcium
   Molecular functionCalcium channel
Ion channel
Voltage-gated channel
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processaxon guidance

Traceable author statement. Source: Reactome

calcium ion import

Inferred from direct assay PubMed 21084288. Source: BHF-UCL

membrane depolarization during action potential

Inferred from Biological aspect of Ancestor. Source: RefGenome

positive regulation of calcium ion-dependent exocytosis

Inferred from Biological aspect of Ancestor. Source: RefGenome

regulation of atrial cardiac muscle cell membrane depolarization

Inferred from electronic annotation. Source: Ensembl

regulation of heart rate

Inferred from electronic annotation. Source: Ensembl

regulation of membrane potential

Inferred from direct assay PubMed 21084288. Source: BHF-UCL

response to nickel cation

Inferred from electronic annotation. Source: Ensembl

synaptic transmission

Inferred from electronic annotation. Source: Ensembl

transport

Traceable author statement Ref.10. Source: ProtInc

   Cellular_componentplasma membrane

Inferred from Biological aspect of Ancestor. Source: RefGenome

voltage-gated calcium channel complex

Traceable author statement Ref.10. Source: ProtInc

   Molecular_functionlow voltage-gated calcium channel activity

Inferred from direct assay PubMed 21084288. Source: BHF-UCL

scaffold protein binding

Inferred from physical interaction PubMed 21084288. Source: BHF-UCL

Complete GO annotation...

Alternative products

This entry describes 35 isoforms produced by alternative splicing. [Align] [Select]
Isoform 5 (identifier: O43497-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 (identifier: O43497-2)

Also known as: Variant 89;

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.
Isoform 2 (identifier: O43497-3)

Also known as: Variant 25;

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1587: NLMLDDVIASGSSASAASE → K
     1928-2020: Missing.
Isoform 3 (identifier: O43497-4)

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
Isoform 4 (identifier: O43497-5)

Also known as: Variant 88;

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.
     2156-2234: Missing.
Isoform 6 (identifier: O43497-6)

Also known as: Variant 217;

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.
Isoform 7 (identifier: O43497-7)

Also known as: Variant 221;

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1976-2020: Missing.
Isoform 8 (identifier: O43497-8)

Also known as: Variant 93;

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1976-2020: Missing.
Isoform 9 (identifier: O43497-9)

Also known as: Variant 57;

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1928-2020: Missing.
Isoform 10 (identifier: O43497-10)

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1928-1975: Missing.
Isoform 11 (identifier: O43497-11)

Also known as: Variant 185;

The sequence of this isoform differs from the canonical sequence as follows:
     1928-2020: Missing.
Isoform 12 (identifier: O43497-12)

Also known as: Variant 189;

The sequence of this isoform differs from the canonical sequence as follows:
     1976-2020: Missing.
Isoform 13 (identifier: O43497-13)

Also known as: Variant 153;

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1928-2020: Missing.
Isoform 14 (identifier: O43497-15)

Also known as: Variant 137;

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1737-1743: Missing.
     1928-2020: Missing.
Isoform 15 (identifier: O43497-16)

Also known as: Variant 157;

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1976-2020: Missing.
Isoform 16 (identifier: O43497-17)

Also known as: Variant 169;

The sequence of this isoform differs from the canonical sequence as follows:
     1737-1743: Missing.
     1928-2020: Missing.
Isoform 17 (identifier: O43497-18)

Also known as: Variant 184;

The sequence of this isoform differs from the canonical sequence as follows:
     1928-2020: Missing.
     2156-2234: Missing.
Isoform 18 (identifier: O43497-19)

Also known as: Variant 216;

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.
     2156-2234: Missing.
Isoform 19 (identifier: O43497-20)

Also known as: Variant 223;

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
Isoform 20 (identifier: O43497-21)

Also known as: Variant 249;

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1569: N → SKEKQMAD
     1928-2020: Missing.
Isoform 21 (identifier: O43497-22)

Also known as: Variant 313;

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1505-1538: Missing.
     1928-2020: Missing.
Isoform 22 (identifier: O43497-23)

Also known as: Variant 409;

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1569-1587: NLMLDDVIASGSSASAASE → K
     1928-2020: Missing.
Isoform 23 (identifier: O43497-24)

Also known as: Variant 441;

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1928-2020: Missing.
Isoform 24 (identifier: O43497-25)

Also known as: Variant 477;

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1976-2020: Missing.
Isoform 25 (identifier: O43497-26)

Also known as: Variant 473;

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.
Isoform 26 (identifier: O43497-27)

Also known as: Variant 17;

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1587: NLMLDDVIASGSSASAASE → K
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.
Isoform 27 (identifier: O43497-28)

Also known as: Variant 33;

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1736-1769: VMQALPQVGNLGLLFMLLFFIFAALGVELFGDLE → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1770-2377: Missing.
Isoform 28 (identifier: O43497-29)

Also known as: Variant 49;

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.
Isoform 29 (identifier: O43497-30)

Also known as: Variant 145;

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.
Isoform 30 (identifier: O43497-31)

Also known as: Variant 177;

The sequence of this isoform differs from the canonical sequence as follows:
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.
Isoform 31 (identifier: O43497-32)

Also known as: Variant 209;

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.
Isoform 32 (identifier: O43497-33)

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
Note: Gene prediction based on EST data.
Isoform 33 (identifier: O43497-34)

Also known as: Variant 441-d81;

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1531: Missing.
     1928-2020: Missing.
Isoform 34 (identifier: O43497-35)

Also known as: Variant 473-d75;

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1529: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.
Isoform 35 (identifier: O43497-36)

Also known as: Variant 473-d81;

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1531: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 23772377Voltage-dependent T-type calcium channel subunit alpha-1G
PRO_0000053952

Regions

Topological domain1 – 8080Cytoplasmic Potential
Transmembrane81 – 10121Helical; Name=S1 of repeat I; Potential
Topological domain102 – 11918Extracellular Potential
Transmembrane120 – 14122Helical; Name=S2 of repeat I; Potential
Topological domain142 – 1509Cytoplasmic Potential
Transmembrane151 – 17020Helical; Name=S3 of repeat I; Potential
Topological domain171 – 1755Extracellular Potential
Transmembrane176 – 19318Helical; Name=S4 of repeat I; Potential
Topological domain194 – 21320Cytoplasmic Potential
Transmembrane214 – 23421Helical; Name=S5 of repeat I; Potential
Topological domain235 – 370136Extracellular Potential
Transmembrane371 – 39525Helical; Name=S6 of repeat I; Potential
Topological domain396 – 743348Cytoplasmic Potential
Transmembrane744 – 76421Helical; Name=S1 of repeat II; Potential
Topological domain765 – 77713Extracellular Potential
Transmembrane778 – 79922Helical; Name=S2 of repeat II; Potential
Topological domain800 – 8056Cytoplasmic Potential
Transmembrane806 – 82419Helical; Name=S3 of repeat II; Potential
Topological domain825 – 8328Extracellular Potential
Transmembrane833 – 85624Helical; Name=S4 of repeat II; Potential
Topological domain857 – 86711Cytoplasmic Potential
Transmembrane868 – 88821Helical; Name=S5 of repeat II; Potential
Topological domain889 – 93951Extracellular Potential
Transmembrane940 – 96425Helical; Name=S6 of repeat II; Potential
Topological domain965 – 1272308Cytoplasmic Potential
Transmembrane1273 – 129523Helical; Name=S1 of repeat III; Potential
Topological domain1296 – 131318Extracellular Potential
Transmembrane1314 – 133421Helical; Name=S2 of repeat III; Potential
Topological domain1335 – 134410Cytoplasmic Potential
Transmembrane1345 – 136420Helical; Name=S3 of repeat III; Potential
Topological domain1365 – 137814Extracellular Potential
Transmembrane1379 – 140022Helical; Name=S4 of repeat III; Potential
Topological domain1401 – 141010Cytoplasmic Potential
Transmembrane1411 – 143424Helical; Name=S5 of repeat III; Potential
Topological domain1435 – 151177Extracellular Potential
Transmembrane1512 – 153726Helical; Name=S6 of repeat III; Potential
Topological domain1538 – 161073Cytoplasmic Potential
Transmembrane1611 – 163121Helical; Name=S1 of repeat IV; Potential
Topological domain1632 – 164514Extracellular Potential
Transmembrane1646 – 166722Helical; Name=S2 of repeat IV; Potential
Topological domain1668 – 16747Cytoplasmic Potential
Transmembrane1675 – 169319Helical; Name=S3 of repeat IV; Potential
Topological domain1694 – 170714Extracellular Potential
Transmembrane1708 – 173124Helical; Name=S4 of repeat IV; Potential
Topological domain1732 – 174514Cytoplasmic Potential
Transmembrane1746 – 176621Helical; Name=S5 of repeat IV; Potential
Topological domain1767 – 182660Extracellular Potential
Transmembrane1827 – 185428Helical; Name=S6 of repeat IV; Potential
Topological domain1855 – 2377523Cytoplasmic Potential
Repeat68 – 398331I
Repeat729 – 967239II
Repeat1263 – 1540278III
Repeat1596 – 1854259IV
Compositional bias290 – 2956Poly-Gly
Compositional bias496 – 50611Poly-His

Sites

Site3541Calcium ion selectivity and permeability By similarity
Site9241Calcium ion selectivity and permeability By similarity
Site14651Calcium ion selectivity and permeability By similarity
Site17701Calcium ion selectivity and permeability By similarity

Amino acid modifications

Glycosylation1731N-linked (GlcNAc...) Potential
Glycosylation2461N-linked (GlcNAc...) Potential
Glycosylation3061N-linked (GlcNAc...) Potential
Glycosylation3101N-linked (GlcNAc...) Potential
Glycosylation3221N-linked (GlcNAc...) Potential
Glycosylation14481N-linked (GlcNAc...) Potential
Glycosylation14511N-linked (GlcNAc...) Potential
Glycosylation16981N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence971 – 99323Missing in isoform 1, isoform 2, isoform 3, isoform 4, isoform 8, isoform 9, isoform 10, isoform 21, isoform 26, isoform 27, isoform 28 and isoform 32.
VSP_000940
Alternative sequence1505 – 153834Missing in isoform 21, isoform 22, isoform 23, isoform 24 and isoform 25.
VSP_047545
Alternative sequence1505 – 153127Missing in isoform 33 and isoform 35.
VSP_047546
Alternative sequence1505 – 152925Missing in isoform 34.
VSP_047547
Alternative sequence1569 – 158719NLMLD…SAASE → K in isoform 2, isoform 13, isoform 14, isoform 15, isoform 22, isoform 26 and isoform 29.
VSP_000944
Alternative sequence1569 – 158618NLMLD…ASAAS → SKEKQMA in isoform 1, isoform 4, isoform 6, isoform 7, isoform 8, isoform 18, isoform 19, isoform 24, isoform 25, isoform 31, isoform 32, isoform 34 and isoform 35.
VSP_000943
Alternative sequence15691N → SKEKQMAD in isoform 20.
VSP_047548
Alternative sequence1736 – 176934VMQAL…FGDLE → LWAWSSLETWSVTRHTPVRA WAVMPPFGTLAWPS in isoform 27.
VSP_047549
Alternative sequence1737 – 17437Missing in isoform 14 and isoform 16.
VSP_047550
Alternative sequence1743 – 177634VGNLG…ETHPC → LWAWSSLETWSVTRHTPVRA WAVMPPFGTLAWPS in isoform 26, isoform 28, isoform 29, isoform 30 and isoform 31.
VSP_047551
Alternative sequence1770 – 2377608Missing in isoform 27.
VSP_047552
Alternative sequence1777 – 2377601Missing in isoform 26, isoform 28, isoform 29, isoform 30 and isoform 31.
VSP_047553
Alternative sequence1928 – 202093Missing in isoform 1, isoform 2, isoform 4, isoform 6, isoform 9, isoform 11, isoform 13, isoform 14, isoform 16, isoform 17, isoform 18, isoform 20, isoform 21, isoform 22, isoform 23, isoform 25, isoform 33, isoform 34 and isoform 35.
VSP_000946
Alternative sequence1928 – 197548Missing in isoform 10.
VSP_000945
Alternative sequence1976 – 202045Missing in isoform 7, isoform 8, isoform 12, isoform 15 and isoform 24.
VSP_000947
Alternative sequence2156 – 223479Missing in isoform 4, isoform 17 and isoform 18.
VSP_000948

Experimental info

Sequence conflict13451S → I in AAD12731. Ref.10

Sequences

Sequence LengthMass (Da)Tools
Isoform 5 [UniParc].

Last modified December 1, 2000. Version 3.
Checksum: 1C9F7C557D9D32DF

FASTA2,377262,472
        10         20         30         40         50         60 
MDEEEDGAGA EESGQPRSFM RLNDLSGAGG RPGPGSAEKD PGSADSEAEG LPYPALAPVV 

        70         80         90        100        110        120 
FFYLSQDSRP RSWCLRTVCN PWFERISMLV ILLNCVTLGM FRPCEDIACD SQRCRILQAF 

       130        140        150        160        170        180 
DDFIFAFFAV EMVVKMVALG IFGKKCYLGD TWNRLDFFIV IAGMLEYSLD LQNVSFSAVR 

       190        200        210        220        230        240 
TVRVLRPLRA INRVPSMRIL VTLLLDTLPM LGNVLLLCFF VFFIFGIVGV QLWAGLLRNR 

       250        260        270        280        290        300 
CFLPENFSLP LSVDLERYYQ TENEDESPFI CSQPRENGMR SCRSVPTLRG DGGGGPPCGL 

       310        320        330        340        350        360 
DYEAYNSSSN TTCVNWNQYY TNCSAGEHNP FKGAINFDNI GYAWIAIFQV ITLEGWVDIM 

       370        380        390        400        410        420 
YFVMDAHSFY NFIYFILLII VGSFFMINLC LVVIATQFSE TKQRESQLMR EQRVRFLSNA 

       430        440        450        460        470        480 
STLASFSEPG SCYEELLKYL VYILRKAARR LAQVSRAAGV RVGLLSSPAP LGGQETQPSS 

       490        500        510        520        530        540 
SCSRSHRRLS VHHLVHHHHH HHHHYHLGNG TLRAPRASPE IQDRDANGSR RLMLPPPSTP 

       550        560        570        580        590        600 
ALSGAPPGGA ESVHSFYHAD CHLEPVRCQA PPPRSPSEAS GRTVGSGKVY PTVHTSPPPE 

       610        620        630        640        650        660 
TLKEKALVEV AASSGPPTLT SLNIPPGPYS SMHKLLETQS TGACQSSCKI SSPCLKADSG 

       670        680        690        700        710        720 
ACGPDSCPYC ARAGAGEVEL ADREMPDSDS EAVYEFTQDA QHSDLRDPHS RRQRSLGPDA 

       730        740        750        760        770        780 
EPSSVLAFWR LICDTFRKIV DSKYFGRGIM IAILVNTLSM GIEYHEQPEE LTNALEISNI 

       790        800        810        820        830        840 
VFTSLFALEM LLKLLVYGPF GYIKNPYNIF DGVIVVISVW EIVGQQGGGL SVLRTFRLMR 

       850        860        870        880        890        900 
VLKLVRFLPA LQRQLVVLMK TMDNVATFCM LLMLFIFIFS ILGMHLFGCK FASERDGDTL 

       910        920        930        940        950        960 
PDRKNFDSLL WAIVTVFQIL TQEDWNKVLY NGMASTSSWA ALYFIALMTF GNYVLFNLLV 

       970        980        990       1000       1010       1020 
AILVEGFQAE EISKREDASG QLSCIQLPVD SQGGDANKSE SEPDFFSPSL DGDGDRKKCL 

      1030       1040       1050       1060       1070       1080 
ALVSLGEHPE LRKSLLPPLI IHTAATPMSL PKSTSTGLGE ALGPASRRTS SSGSAEPGAA 

      1090       1100       1110       1120       1130       1140 
HEMKSPPSAR SSPHSPWSAA SSWTSRRSSR NSLGRAPSLK RRSPSGERRS LLSGEGQESQ 

      1150       1160       1170       1180       1190       1200 
DEEESSEEER ASPAGSDHRH RGSLEREAKS SFDLPDTLQV PGLHRTASGR GSASEHQDCN 

      1210       1220       1230       1240       1250       1260 
GKSASGRLAR ALRPDDPPLD GDDADDEGNL SKGERVRAWI RARLPACCLE RDSWSAYIFP 

      1270       1280       1290       1300       1310       1320 
PQSRFRLLCH RIITHKMFDH VVLVIIFLNC ITIAMERPKI DPHSAERIFL TLSNYIFTAV 

      1330       1340       1350       1360       1370       1380 
FLAEMTVKVV ALGWCFGEQA YLRSSWNVLD GLLVLISVID ILVSMVSDSG TKILGMLRVL 

      1390       1400       1410       1420       1430       1440 
RLLRTLRPLR VISRAQGLKL VVETLMSSLK PIGNIVVICC AFFIIFGILG VQLFKGKFFV 

      1450       1460       1470       1480       1490       1500 
CQGEDTRNIT NKSDCAEASY RWVRHKYNFD NLGQALMSLF VLASKDGWVD IMYDGLDAVG 

      1510       1520       1530       1540       1550       1560 
VDQQPIMNHN PWMLLYFISF LLIVAFFVLN MFVGVVVENF HKCRQHQEEE EARRREEKRL 

      1570       1580       1590       1600       1610       1620 
RRLEKKRRNL MLDDVIASGS SASAASEAQC KPYYSDYSRF RLLVHHLCTS HYLDLFITGV 

      1630       1640       1650       1660       1670       1680 
IGLNVVTMAM EHYQQPQILD EALKICNYIF TVIFVLESVF KLVAFGFRRF FQDRWNQLDL 

      1690       1700       1710       1720       1730       1740 
AIVLLSIMGI TLEEIEVNAS LPINPTIIRI MRVLRIARVL KLLKMAVGMR ALLDTVMQAL 

      1750       1760       1770       1780       1790       1800 
PQVGNLGLLF MLLFFIFAAL GVELFGDLEC DETHPCEGLG RHATFRNFGM AFLTLFRVST 

      1810       1820       1830       1840       1850       1860 
GDNWNGIMKD TLRDCDQEST CYNTVISPIY FVSFVLTAQF VLVNVVIAVL MKHLEESNKE 

      1870       1880       1890       1900       1910       1920 
AKEEAELEAE LELEMKTLSP QPHSPLGSPF LWPGVEGPDS PDSPKPGALH PAAHARSASH 

      1930       1940       1950       1960       1970       1980 
FSLEHPTDRQ LFDTISLLIQ GSLEWELKLM DELAGPGGQP SAFPSAPSLG GSDPQIPLAE 

      1990       2000       2010       2020       2030       2040 
MEALSLTSEI VSEPSCSLAL TDDSLPDDMH TLLLSALESN MQPHPTELPG PDLLTVRKSG 

      2050       2060       2070       2080       2090       2100 
VSRTHSLPND SYMCRHGSTA EGPLGHRGWG LPKAQSGSVL SVHSQPADTS YILQLPKDAP 

      2110       2120       2130       2140       2150       2160 
HLLQPHSAPT WGTIPKLPPP GRSPLAQRPL RRQAAIRTDS LDVQGLGSRE DLLAEVSGPS 

      2170       2180       2190       2200       2210       2220 
PPLARAYSFW GQSSTQAQQH SRSHSKISKH MTPPAPCPGP EPNWGKGPPE TRSSLELDTE 

      2230       2240       2250       2260       2270       2280 
LSWISGDLLP PGGQEEPPSP RDLKKCYSVE AQSCQRRPTS WLDEQRRHSI AVSCLDSGSQ 

      2290       2300       2310       2320       2330       2340 
PHLGTDPSNL GGQPLGGPGS RPKKKLSPPS ITIDPPESQG PRTPPSPGIC LRRRAPSSDS 

      2350       2360       2370 
KDPLASGPPD SMAASPSPKK DVLSLSGLSS DPADLDP 

« Hide

Isoform 1 (Variant 89) [UniParc].

Checksum: ACDCB167AA5DF18F
Show »

FASTA2,250249,333
Isoform 2 (Variant 25) [UniParc].

Checksum: 74FA50071A5F9FBD
Show »

FASTA2,243248,529
Isoform 3 [UniParc].

Checksum: 2F13189AF179C9E2
Show »

FASTA2,354260,029
Isoform 4 (Variant 88) [UniParc].

Checksum: 1C5BEDD83C1C8FB7
Show »

FASTA2,171240,920
Isoform 6 (Variant 217) [UniParc].

Checksum: BBE93AF4CCAC8F8D
Show »

FASTA2,273251,776
Isoform 7 (Variant 221) [UniParc].

Checksum: 2051A97223D0081D
Show »

FASTA2,321256,828
Isoform 8 (Variant 93) [UniParc].

Checksum: EF51D26EC38F66F8
Show »

FASTA2,298254,386
Isoform 9 (Variant 57) [UniParc].

Checksum: DCA090B5433D83E1
Show »

FASTA2,261250,221
Isoform 10 [UniParc].

Checksum: 943D153CFCC75CF8
Show »

FASTA2,306254,976
Isoform 11 (Variant 185) [UniParc].

Checksum: FCB59420799A126E
Show »

FASTA2,284252,664
Isoform 12 (Variant 189) [UniParc].

Checksum: 74F41CEA601E8CBC
Show »

FASTA2,332257,716
Isoform 13 (Variant 153) [UniParc].

Checksum: 66E3563375ED61DA
Show »

FASTA2,266250,972
Isoform 14 (Variant 137) [UniParc].

Checksum: 4DB0EDC2873FB788
Show »

FASTA2,259250,204
Isoform 15 (Variant 157) [UniParc].

Checksum: 8C9D69B5A3C86C21
Show »

FASTA2,314256,024
Isoform 16 (Variant 169) [UniParc].

Checksum: B942CD535E125104
Show »

FASTA2,277251,896
Isoform 17 (Variant 184) [UniParc].

Checksum: E059BCB89C6929DA
Show »

FASTA2,205244,250
Isoform 18 (Variant 216) [UniParc].

Checksum: 1A2CC9E24EDDECA1
Show »

FASTA2,194243,362
Isoform 19 (Variant 223) [UniParc].

Checksum: 2CBDED941FB8B793
Show »

FASTA2,366261,584
Isoform 20 (Variant 249) [UniParc].

Checksum: 031D1E0372857147
Show »

FASTA2,291253,467
Isoform 21 (Variant 313) [UniParc].

Checksum: E0F263D2479502B0
Show »

FASTA2,227246,224
Isoform 22 (Variant 409) [UniParc].

Checksum: CC32AACAC448BE1A
Show »

FASTA2,232246,975
Isoform 23 (Variant 441) [UniParc].

Checksum: 3196A2446C52D0D5
Show »

FASTA2,250248,667
Isoform 24 (Variant 477) [UniParc].

Checksum: 38379DC69AAACA57
Show »

FASTA2,287252,831
Isoform 25 (Variant 473) [UniParc].

Checksum: 15CBEF30957AAB27
Show »

FASTA2,239247,779
Isoform 26 (Variant 17) [UniParc].

Checksum: F8C3FE1FDB00B3A8
Show »

FASTA1,735194,084
Isoform 27 (Variant 33) [UniParc].

Checksum: F7562C646DF6275D
Show »

FASTA1,746195,008
Isoform 28 (Variant 49) [UniParc].

Checksum: 0A6D75AA5418BCCA
Show »

FASTA1,753195,776
Isoform 29 (Variant 145) [UniParc].

Checksum: 79746C4F53C48A96
Show »

FASTA1,758196,527
Isoform 30 (Variant 177) [UniParc].

Checksum: 8A58FF574B070494
Show »

FASTA1,776198,218
Isoform 31 (Variant 209) [UniParc].

Checksum: C26247C1EAE03CFE
Show »

FASTA1,765197,330
Isoform 32 [UniParc].

Checksum: 01E1315F5E43FF9C
Show »

FASTA2,343259,141
Isoform 33 (Variant 441-d81) [UniParc].

Checksum: 7271F3B05E9438BA
Show »

FASTA2,257249,396
Isoform 34 (Variant 473-d75) [UniParc].

Checksum: 302BC6EC72A65A1F
Show »

FASTA2,248248,754
Isoform 35 (Variant 473-d81) [UniParc].

Checksum: F99DA2229E40387E
Show »

FASTA2,246248,509

References

« Hide 'large scale' references
[1]"Inactivation of CACNA1G, a T-type calcium channel gene, by aberrant methylation of its 5' CpG island in human tumors."
Toyota M., Ho C., Ohe-Toyota M., Baylin S.B., Issa J.-P.J.
Cancer Res. 59:4535-4541(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), GENE STRUCTURE.
Tissue: Prostatic carcinoma.
[2]"Structure and alternative splicing of the gene encoding alpha1G, a human brain T calcium channel alpha1 subunit."
Mittman S., Guo J., Agnew W.S.
Neurosci. Lett. 274:143-146(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS 4 AND 5).
Tissue: Brain.
[3]"Molecular cloning and functional expression of ca(v)3.1c, a T-type calcium channel from human brain."
Cribbs L.L., Gomora J.C., Daud A.N., Lee J.-H., Perez-Reyes E.
FEBS Lett. 466:54-58(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[4]"Molecular and functional properties of the human alpha1G subunit that forms T-type calcium channels."
Monteil A., Chemin J., Bourinet E., Mennessier G., Lory P., Nargeot J.
J. Biol. Chem. 275:6090-6100(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS 1-2 AND 6-13).
Tissue: Brain.
[5]"Profiling the array of Ca(v)3.1 variants from the human T-type calcium channel gene CACNA1G: alternative structures, developmental expression, and biophysical variations."
Emerick M.C., Stein R., Kunze R., McNulty M.M., Regan M.R., Hanck D.A., Agnew W.S.
Proteins 64:320-342(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4; 6; 7; 8; 9; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20; 21; 22; 23; 24; 25; 26; 27; 28; 29; 30; 31; 33; 34 AND 35), DEVELOPMENTAL STAGE.
Tissue: Brain and Fetal brain.
[6]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9).
[8]"Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 550-2377 (ISOFORM 13).
Tissue: Brain.
[9]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[10]"Molecular characterization of a neuronal low-voltage-activated T-type calcium channel."
Perez-Reyes E., Cribbs L.L., Daud A., Lacerda A.E., Barclay J., Williamson M.P., Fox M., Rees M., Lee J.-H.
Nature 391:896-900(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1126-1444; 1778-1927 AND 2021-2312.
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF124351 mRNA. Translation: AAD34352.1.
AF134985 mRNA. Translation: AAF19346.1.
AF134986 mRNA. Translation: AAF19347.1.
AF190860 mRNA. Translation: AAF35287.1.
AF126965 mRNA. Translation: AAD29400.1.
AF126966 mRNA. Translation: AAD29401.1.
AF227744 mRNA. Translation: AAF37689.1.
AF227745 mRNA. Translation: AAF37690.1.
AF227746 mRNA. Translation: AAF37691.1.
AF227747 mRNA. Translation: AAF37692.1.
AF227748 mRNA. Translation: AAF37693.1.
AF227749 mRNA. Translation: AAF37694.1.
AF227750 mRNA. Translation: AAF37695.1.
AF227751 mRNA. Translation: AAF37696.1.
DQ494449 mRNA. Translation: ABF69900.1.
DQ494450 mRNA. Translation: ABF69901.1.
DQ494451 mRNA. Translation: ABF69902.1.
DQ494452 mRNA. Translation: ABF69903.1.
DQ494453 mRNA. Translation: ABF69904.1.
DQ494454 mRNA. Translation: ABF69905.1.
DQ494455 mRNA. Translation: ABF69906.1.
DQ494456 mRNA. Translation: ABF69907.1.
DQ494457 mRNA. Translation: ABF69908.1.
DQ494458 mRNA. Translation: ABF69909.1.
DQ494459 mRNA. Translation: ABF69910.1.
DQ494460 mRNA. Translation: ABF69911.1.
DQ494461 mRNA. Translation: ABF69912.1.
DQ494462 mRNA. Translation: ABF69913.1.
DQ494463 mRNA. Translation: ABF69914.1.
DQ494464 mRNA. Translation: ABF69915.1.
DQ494465 mRNA. Translation: ABF69916.1.
DQ494466 mRNA. Translation: ABF69917.1.
DQ494467 mRNA. Translation: ABF69918.1.
DQ494468 mRNA. Translation: ABF69919.1.
DQ494469 mRNA. Translation: ABF69920.1.
DQ494470 mRNA. Translation: ABF69921.1.
DQ494471 mRNA. Translation: ABF69922.1.
DQ494472 mRNA. Translation: ABF69923.1.
DQ494473 mRNA. Translation: ABF69924.1.
DQ494474 mRNA. Translation: ABF69925.1.
DQ494475 mRNA. Translation: ABF69926.1.
DQ494476 mRNA. Translation: ABF69927.1.
DQ494477 mRNA. Translation: ABF69928.1.
DQ494478 mRNA. Translation: ABF69929.1.
DQ494479 mRNA. Translation: ABF69930.1.
AC004590 Genomic DNA. No translation available.
AC021491 Genomic DNA. No translation available.
BC110995 mRNA. Translation: AAI10996.1.
AB032949 mRNA. Translation: BAA86437.2.
AF029228 mRNA. Translation: AAD12731.1.
AF029229 mRNA. Translation: AAD12732.1.
CCDSCCDS45730.1. [O43497-1]
CCDS45731.1. [O43497-12]
CCDS45732.1. [O43497-11]
CCDS45733.1. [O43497-13]
CCDS45734.1. [O43497-33]
CCDS45735.1. [O43497-2]
CCDS45736.1. [O43497-5]
CCDS45737.1. [O43497-10]
CCDS54142.1. [O43497-7]
CCDS54143.1. [O43497-6]
CCDS54144.1. [O43497-9]
CCDS54145.1. [O43497-3]
CCDS54146.1. [O43497-8]
CCDS58565.1. [O43497-17]
CCDS58566.1. [O43497-18]
CCDS58567.1. [O43497-15]
CCDS58568.1. [O43497-16]
CCDS58569.1. [O43497-21]
CCDS58570.1. [O43497-20]
CCDS58571.1. [O43497-19]
CCDS58572.1. [O43497-24]
CCDS58573.1. [O43497-23]
CCDS58574.1. [O43497-25]
CCDS58575.1. [O43497-26]
CCDS58576.1. [O43497-22]
RefSeqNP_001243253.1. NM_001256324.1. [O43497-16]
NP_001243254.1. NM_001256325.1. [O43497-21]
NP_001243255.1. NM_001256326.1. [O43497-25]
NP_001243256.1. NM_001256327.1. [O43497-17]
NP_001243257.1. NM_001256328.1. [O43497-15]
NP_001243258.1. NM_001256329.1. [O43497-24]
NP_001243259.1. NM_001256330.1. [O43497-26]
NP_001243260.1. NM_001256331.1. [O43497-23]
NP_001243261.1. NM_001256332.1. [O43497-22]
NP_001243262.1. NM_001256333.1. [O43497-18]
NP_001243263.1. NM_001256334.1. [O43497-19]
NP_001243288.1. NM_001256359.1. [O43497-34]
NP_001243289.1. NM_001256360.1. [O43497-35]
NP_001243290.1. NM_001256361.1. [O43497-36]
NP_061496.2. NM_018896.4. [O43497-1]
NP_938190.1. NM_198376.2. [O43497-5]
NP_938191.2. NM_198377.2. [O43497-20]
NP_938192.1. NM_198378.2. [O43497-6]
NP_938193.1. NM_198379.2. [O43497-8]
NP_938194.1. NM_198380.2. [O43497-7]
NP_938196.1. NM_198382.2. [O43497-9]
NP_938197.1. NM_198383.2. [O43497-10]
NP_938198.1. NM_198384.2. [O43497-11]
NP_938199.1. NM_198385.2. [O43497-12]
NP_938200.1. NM_198386.2. [O43497-13]
NP_938201.1. NM_198387.2. [O43497-2]
NP_938202.1. NM_198388.2. [O43497-3]
NP_938406.1. NM_198396.2. [O43497-33]
UniGeneHs.591169.

3D structure databases

ProteinModelPortalO43497.
SMRO43497. Positions 82-234, 745-976, 1278-1549, 1617-1863.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114427. 1 interaction.
IntActO43497. 2 interactions.
MINTMINT-2796172.

Chemistry

BindingDBO43497.
ChEMBLCHEMBL2362995.
DrugBankDB00593. Ethosuximide.
DB04841. Flunarizine.
DB01202. Levetiracetam.
DB01388. Mibefradil.
DB01100. Pimozide.
DB00347. Trimethadione.
DB00661. Verapamil.
DB00909. Zonisamide.
GuidetoPHARMACOLOGY535.

PTM databases

PhosphoSiteO43497.

Proteomic databases

PaxDbO43497.
PRIDEO43497.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000352832; ENSP00000339302; ENSG00000006283. [O43497-2]
ENST00000354983; ENSP00000347078; ENSG00000006283. [O43497-33]
ENST00000358244; ENSP00000350979; ENSG00000006283. [O43497-5]
ENST00000359106; ENSP00000352011; ENSG00000006283. [O43497-1]
ENST00000360761; ENSP00000353990; ENSG00000006283. [O43497-9]
ENST00000429973; ENSP00000414388; ENSG00000006283. [O43497-13]
ENST00000442258; ENSP00000409759; ENSG00000006283. [O43497-3]
ENST00000502264; ENSP00000425522; ENSG00000006283. [O43497-10]
ENST00000503436; ENSP00000427231; ENSG00000006283. [O43497-29]
ENST00000503485; ENSP00000427238; ENSG00000006283. [O43497-24]
ENST00000503607; ENSP00000426558; ENSG00000006283. [O43497-27]
ENST00000504076; ENSP00000425153; ENSG00000006283. [O43497-32]
ENST00000505165; ENSP00000422268; ENSG00000006283. [O43497-18]
ENST00000506406; ENSP00000426313; ENSG00000006283. [O43497-31]
ENST00000507336; ENSP00000420918; ENSG00000006283. [O43497-20]
ENST00000507510; ENSP00000423112; ENSG00000006283. [O43497-12]
ENST00000507609; ENSP00000423045; ENSG00000006283. [O43497-17]
ENST00000507896; ENSP00000421518; ENSG00000006283. [O43497-19]
ENST00000510115; ENSP00000427173; ENSG00000006283. [O43497-8]
ENST00000510366; ENSP00000426814; ENSG00000006283. [O43497-23]
ENST00000511765; ENSP00000427247; ENSG00000006283. [O43497-30]
ENST00000511768; ENSP00000424664; ENSG00000006283. [O43497-28]
ENST00000512389; ENSP00000426261; ENSG00000006283. [O43497-6]
ENST00000513689; ENSP00000426172; ENSG00000006283. [O43497-25]
ENST00000513964; ENSP00000425451; ENSG00000006283. [O43497-26]
ENST00000514079; ENSP00000423317; ENSG00000006283. [O43497-21]
ENST00000514181; ENSP00000425698; ENSG00000006283. [O43497-15]
ENST00000514717; ENSP00000422407; ENSG00000006283. [O43497-22]
ENST00000515165; ENSP00000426098; ENSG00000006283. [O43497-11]
ENST00000515411; ENSP00000423155; ENSG00000006283. [O43497-16]
ENST00000515765; ENSP00000426232; ENSG00000006283. [O43497-7]
GeneID8913.
KEGGhsa:8913.
UCSCuc002irk.2. human. [O43497-1]
uc002irl.2. human.
uc002irw.2. human. [O43497-10]

Organism-specific databases

CTD8913.
GeneCardsGC17P048639.
HGNCHGNC:1394. CACNA1G.
HPAHPA004714.
MIM604065. gene.
neXtProtNX_O43497.
PharmGKBPA381.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1226.
HOVERGENHBG050764.
InParanoidO43497.
KOK04854.
OMAQRCRILQ.
OrthoDBEOG7MKW55.
PhylomeDBO43497.
TreeFamTF313555.

Enzyme and pathway databases

ReactomeREACT_111045. Developmental Biology.

Gene expression databases

ArrayExpressO43497.
BgeeO43497.
GenevestigatorO43497.

Family and domain databases

Gene3D1.20.120.350. 4 hits.
InterProIPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR005445. VDCC_T_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamPF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSPR00167. CACHANNEL.
PR01629. TVDCCALPHA1.
ProtoNetSearch...

Other

ChiTaRSCACNA1G. human.
GeneWikiCACNA1G.
GenomeRNAi8913.
NextBio33500.
PROO43497.
SOURCESearch...

Entry information

Entry nameCAC1G_HUMAN
AccessionPrimary (citable) accession number: O43497
Secondary accession number(s): D6RA64 expand/collapse secondary AC list , E7EPR0, O43498, O94770, Q19QY8, Q19QY9, Q19QZ0, Q19QZ1, Q19QZ2, Q19QZ3, Q19QZ4, Q19QZ5, Q19QZ6, Q19QZ7, Q19QZ8, Q19QZ9, Q19R00, Q19R01, Q19R02, Q19R03, Q19R04, Q19R05, Q19R06, Q19R07, Q19R08, Q19R09, Q19R10, Q19R11, Q19R12, Q19R13, Q19R15, Q19R16, Q19R17, Q19R18, Q2TAC4, Q9NYU4, Q9NYU5, Q9NYU6, Q9NYU7, Q9NYU8, Q9NYU9, Q9NYV0, Q9NYV1, Q9UHN9, Q9UHP0, Q9ULU6, Q9UNG7, Q9Y5T2, Q9Y5T3
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: December 1, 2000
Last modified: July 9, 2014
This is version 128 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM