Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O43497

- CAC1G_HUMAN

UniProt

O43497 - CAC1G_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Voltage-dependent T-type calcium channel subunit alpha-1G

Gene

CACNA1G

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1G gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by mibefradil. A particularity of this type of channel is an opening at quite negative potentials and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei354 – 3541Calcium ion selectivity and permeabilityBy similarity
Sitei924 – 9241Calcium ion selectivity and permeabilityBy similarity
Sitei1465 – 14651Calcium ion selectivity and permeabilityBy similarity
Sitei1770 – 17701Calcium ion selectivity and permeabilityBy similarity

GO - Molecular functioni

  1. low voltage-gated calcium channel activity Source: BHF-UCL
  2. scaffold protein binding Source: BHF-UCL

GO - Biological processi

  1. axon guidance Source: Reactome
  2. calcium ion import Source: BHF-UCL
  3. membrane depolarization during action potential Source: RefGenome
  4. positive regulation of calcium ion-dependent exocytosis Source: RefGenome
  5. regulation of atrial cardiac muscle cell membrane depolarization Source: Ensembl
  6. regulation of heart rate Source: Ensembl
  7. regulation of membrane potential Source: BHF-UCL
  8. response to nickel cation Source: Ensembl
  9. synaptic transmission Source: Ensembl
  10. transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_18312. NCAM1 interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent T-type calcium channel subunit alpha-1G
Alternative name(s):
Cav3.1c
NBR13
Voltage-gated calcium channel subunit alpha Cav3.1
Gene namesi
Name:CACNA1G
Synonyms:KIAA1123
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:1394. CACNA1G.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 8080CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei81 – 10121Helical; Name=S1 of repeat ISequence AnalysisAdd
BLAST
Topological domaini102 – 11918ExtracellularSequence AnalysisAdd
BLAST
Transmembranei120 – 14122Helical; Name=S2 of repeat ISequence AnalysisAdd
BLAST
Topological domaini142 – 1509CytoplasmicSequence Analysis
Transmembranei151 – 17020Helical; Name=S3 of repeat ISequence AnalysisAdd
BLAST
Topological domaini171 – 1755ExtracellularSequence Analysis
Transmembranei176 – 19318Helical; Name=S4 of repeat ISequence AnalysisAdd
BLAST
Topological domaini194 – 21320CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei214 – 23421Helical; Name=S5 of repeat ISequence AnalysisAdd
BLAST
Topological domaini235 – 370136ExtracellularSequence AnalysisAdd
BLAST
Transmembranei371 – 39525Helical; Name=S6 of repeat ISequence AnalysisAdd
BLAST
Topological domaini396 – 743348CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei744 – 76421Helical; Name=S1 of repeat IISequence AnalysisAdd
BLAST
Topological domaini765 – 77713ExtracellularSequence AnalysisAdd
BLAST
Transmembranei778 – 79922Helical; Name=S2 of repeat IISequence AnalysisAdd
BLAST
Topological domaini800 – 8056CytoplasmicSequence Analysis
Transmembranei806 – 82419Helical; Name=S3 of repeat IISequence AnalysisAdd
BLAST
Topological domaini825 – 8328ExtracellularSequence Analysis
Transmembranei833 – 85624Helical; Name=S4 of repeat IISequence AnalysisAdd
BLAST
Topological domaini857 – 86711CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei868 – 88821Helical; Name=S5 of repeat IISequence AnalysisAdd
BLAST
Topological domaini889 – 93951ExtracellularSequence AnalysisAdd
BLAST
Transmembranei940 – 96425Helical; Name=S6 of repeat IISequence AnalysisAdd
BLAST
Topological domaini965 – 1272308CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei1273 – 129523Helical; Name=S1 of repeat IIISequence AnalysisAdd
BLAST
Topological domaini1296 – 131318ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1314 – 133421Helical; Name=S2 of repeat IIISequence AnalysisAdd
BLAST
Topological domaini1335 – 134410CytoplasmicSequence Analysis
Transmembranei1345 – 136420Helical; Name=S3 of repeat IIISequence AnalysisAdd
BLAST
Topological domaini1365 – 137814ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1379 – 140022Helical; Name=S4 of repeat IIISequence AnalysisAdd
BLAST
Topological domaini1401 – 141010CytoplasmicSequence Analysis
Transmembranei1411 – 143424Helical; Name=S5 of repeat IIISequence AnalysisAdd
BLAST
Topological domaini1435 – 151177ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1512 – 153726Helical; Name=S6 of repeat IIISequence AnalysisAdd
BLAST
Topological domaini1538 – 161073CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei1611 – 163121Helical; Name=S1 of repeat IVSequence AnalysisAdd
BLAST
Topological domaini1632 – 164514ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1646 – 166722Helical; Name=S2 of repeat IVSequence AnalysisAdd
BLAST
Topological domaini1668 – 16747CytoplasmicSequence Analysis
Transmembranei1675 – 169319Helical; Name=S3 of repeat IVSequence AnalysisAdd
BLAST
Topological domaini1694 – 170714ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1708 – 173124Helical; Name=S4 of repeat IVSequence AnalysisAdd
BLAST
Topological domaini1732 – 174514CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei1746 – 176621Helical; Name=S5 of repeat IVSequence AnalysisAdd
BLAST
Topological domaini1767 – 182660ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1827 – 185428Helical; Name=S6 of repeat IVSequence AnalysisAdd
BLAST
Topological domaini1855 – 2377523CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. plasma membrane Source: RefGenome
  2. voltage-gated calcium channel complex Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA381.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 23772377Voltage-dependent T-type calcium channel subunit alpha-1GPRO_0000053952Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi173 – 1731N-linked (GlcNAc...)Sequence Analysis
Glycosylationi246 – 2461N-linked (GlcNAc...)Sequence Analysis
Glycosylationi306 – 3061N-linked (GlcNAc...)Sequence Analysis
Glycosylationi310 – 3101N-linked (GlcNAc...)Sequence Analysis
Glycosylationi322 – 3221N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1448 – 14481N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1451 – 14511N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1698 – 16981N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

In response to raising of intracellular calcium, the T-type channels are activated by CaM-kinase II.

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiO43497.
PRIDEiO43497.

PTM databases

PhosphoSiteiO43497.

Expressioni

Tissue specificityi

Highly expressed in brain, in particular in the amygdala, subthalamic nuclei, cerebellum and thalamus. Moderate expression in heart; low expression in placenta, kidney and lung. Also expressed in colon and bone marrow and in tumoral cells to a lesser extent. Highly expressed in fetal brain, but also in peripheral fetal tissues as heart, kidney and lung, suggesting a developmentally regulated expression.

Developmental stagei

Isoform 4, isoform 7, isoform 18, isoform 19, isoform 24, isoform 25 and isoform 31 are adult-specific. Isoform 8, isoform 14, isoform 15, isoform 16, isoform 17, isoform 20, isoform 21, isoform 22, isoform 23, isoform 26, isoform 27, isoform 28, isoform 29 and isoform 30 are fetal-specific. Isoform 1, isoform 2, isoform 6, isoform 9, isoform 11, isoform 12 and isoform 13 are expressed in both fetus and adult.1 Publication

Gene expression databases

BgeeiO43497.
ExpressionAtlasiO43497. baseline and differential.
GenevestigatoriO43497.

Organism-specific databases

HPAiHPA004714.

Interactioni

Protein-protein interaction databases

BioGridi114427. 1 interaction.
IntActiO43497. 2 interactions.
MINTiMINT-2796172.

Structurei

3D structure databases

ProteinModelPortaliO43497.
SMRiO43497. Positions 82-234, 745-976, 1278-1549, 1617-1863.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati68 – 398331IAdd
BLAST
Repeati729 – 967239IIAdd
BLAST
Repeati1263 – 1540278IIIAdd
BLAST
Repeati1596 – 1854259IVAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi290 – 2956Poly-Gly
Compositional biasi496 – 50611Poly-HisAdd
BLAST

Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.
The linker region between repeat III and IV probably plays a role in the inactivation of the channel. The C-terminal part may be implicated in the anchoring of the protein to the membrane by interfering with or restricting its lateral diffusion.

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1226.
GeneTreeiENSGT00760000118827.
HOVERGENiHBG050764.
InParanoidiO43497.
KOiK04854.
OMAiQRCRILQ.
OrthoDBiEOG7MKW55.
PhylomeDBiO43497.
TreeFamiTF313555.

Family and domain databases

Gene3Di1.20.120.350. 4 hits.
InterProiIPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR005445. VDCC_T_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamiPF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01629. TVDCCALPHA1.

Sequences (35)i

Sequence statusi: Complete.

This entry describes 35 isoformsi produced by alternative splicing. Align

Isoform 5 (identifier: O43497-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEEEDGAGA EESGQPRSFM RLNDLSGAGG RPGPGSAEKD PGSADSEAEG
60 70 80 90 100
LPYPALAPVV FFYLSQDSRP RSWCLRTVCN PWFERISMLV ILLNCVTLGM
110 120 130 140 150
FRPCEDIACD SQRCRILQAF DDFIFAFFAV EMVVKMVALG IFGKKCYLGD
160 170 180 190 200
TWNRLDFFIV IAGMLEYSLD LQNVSFSAVR TVRVLRPLRA INRVPSMRIL
210 220 230 240 250
VTLLLDTLPM LGNVLLLCFF VFFIFGIVGV QLWAGLLRNR CFLPENFSLP
260 270 280 290 300
LSVDLERYYQ TENEDESPFI CSQPRENGMR SCRSVPTLRG DGGGGPPCGL
310 320 330 340 350
DYEAYNSSSN TTCVNWNQYY TNCSAGEHNP FKGAINFDNI GYAWIAIFQV
360 370 380 390 400
ITLEGWVDIM YFVMDAHSFY NFIYFILLII VGSFFMINLC LVVIATQFSE
410 420 430 440 450
TKQRESQLMR EQRVRFLSNA STLASFSEPG SCYEELLKYL VYILRKAARR
460 470 480 490 500
LAQVSRAAGV RVGLLSSPAP LGGQETQPSS SCSRSHRRLS VHHLVHHHHH
510 520 530 540 550
HHHHYHLGNG TLRAPRASPE IQDRDANGSR RLMLPPPSTP ALSGAPPGGA
560 570 580 590 600
ESVHSFYHAD CHLEPVRCQA PPPRSPSEAS GRTVGSGKVY PTVHTSPPPE
610 620 630 640 650
TLKEKALVEV AASSGPPTLT SLNIPPGPYS SMHKLLETQS TGACQSSCKI
660 670 680 690 700
SSPCLKADSG ACGPDSCPYC ARAGAGEVEL ADREMPDSDS EAVYEFTQDA
710 720 730 740 750
QHSDLRDPHS RRQRSLGPDA EPSSVLAFWR LICDTFRKIV DSKYFGRGIM
760 770 780 790 800
IAILVNTLSM GIEYHEQPEE LTNALEISNI VFTSLFALEM LLKLLVYGPF
810 820 830 840 850
GYIKNPYNIF DGVIVVISVW EIVGQQGGGL SVLRTFRLMR VLKLVRFLPA
860 870 880 890 900
LQRQLVVLMK TMDNVATFCM LLMLFIFIFS ILGMHLFGCK FASERDGDTL
910 920 930 940 950
PDRKNFDSLL WAIVTVFQIL TQEDWNKVLY NGMASTSSWA ALYFIALMTF
960 970 980 990 1000
GNYVLFNLLV AILVEGFQAE EISKREDASG QLSCIQLPVD SQGGDANKSE
1010 1020 1030 1040 1050
SEPDFFSPSL DGDGDRKKCL ALVSLGEHPE LRKSLLPPLI IHTAATPMSL
1060 1070 1080 1090 1100
PKSTSTGLGE ALGPASRRTS SSGSAEPGAA HEMKSPPSAR SSPHSPWSAA
1110 1120 1130 1140 1150
SSWTSRRSSR NSLGRAPSLK RRSPSGERRS LLSGEGQESQ DEEESSEEER
1160 1170 1180 1190 1200
ASPAGSDHRH RGSLEREAKS SFDLPDTLQV PGLHRTASGR GSASEHQDCN
1210 1220 1230 1240 1250
GKSASGRLAR ALRPDDPPLD GDDADDEGNL SKGERVRAWI RARLPACCLE
1260 1270 1280 1290 1300
RDSWSAYIFP PQSRFRLLCH RIITHKMFDH VVLVIIFLNC ITIAMERPKI
1310 1320 1330 1340 1350
DPHSAERIFL TLSNYIFTAV FLAEMTVKVV ALGWCFGEQA YLRSSWNVLD
1360 1370 1380 1390 1400
GLLVLISVID ILVSMVSDSG TKILGMLRVL RLLRTLRPLR VISRAQGLKL
1410 1420 1430 1440 1450
VVETLMSSLK PIGNIVVICC AFFIIFGILG VQLFKGKFFV CQGEDTRNIT
1460 1470 1480 1490 1500
NKSDCAEASY RWVRHKYNFD NLGQALMSLF VLASKDGWVD IMYDGLDAVG
1510 1520 1530 1540 1550
VDQQPIMNHN PWMLLYFISF LLIVAFFVLN MFVGVVVENF HKCRQHQEEE
1560 1570 1580 1590 1600
EARRREEKRL RRLEKKRRNL MLDDVIASGS SASAASEAQC KPYYSDYSRF
1610 1620 1630 1640 1650
RLLVHHLCTS HYLDLFITGV IGLNVVTMAM EHYQQPQILD EALKICNYIF
1660 1670 1680 1690 1700
TVIFVLESVF KLVAFGFRRF FQDRWNQLDL AIVLLSIMGI TLEEIEVNAS
1710 1720 1730 1740 1750
LPINPTIIRI MRVLRIARVL KLLKMAVGMR ALLDTVMQAL PQVGNLGLLF
1760 1770 1780 1790 1800
MLLFFIFAAL GVELFGDLEC DETHPCEGLG RHATFRNFGM AFLTLFRVST
1810 1820 1830 1840 1850
GDNWNGIMKD TLRDCDQEST CYNTVISPIY FVSFVLTAQF VLVNVVIAVL
1860 1870 1880 1890 1900
MKHLEESNKE AKEEAELEAE LELEMKTLSP QPHSPLGSPF LWPGVEGPDS
1910 1920 1930 1940 1950
PDSPKPGALH PAAHARSASH FSLEHPTDRQ LFDTISLLIQ GSLEWELKLM
1960 1970 1980 1990 2000
DELAGPGGQP SAFPSAPSLG GSDPQIPLAE MEALSLTSEI VSEPSCSLAL
2010 2020 2030 2040 2050
TDDSLPDDMH TLLLSALESN MQPHPTELPG PDLLTVRKSG VSRTHSLPND
2060 2070 2080 2090 2100
SYMCRHGSTA EGPLGHRGWG LPKAQSGSVL SVHSQPADTS YILQLPKDAP
2110 2120 2130 2140 2150
HLLQPHSAPT WGTIPKLPPP GRSPLAQRPL RRQAAIRTDS LDVQGLGSRE
2160 2170 2180 2190 2200
DLLAEVSGPS PPLARAYSFW GQSSTQAQQH SRSHSKISKH MTPPAPCPGP
2210 2220 2230 2240 2250
EPNWGKGPPE TRSSLELDTE LSWISGDLLP PGGQEEPPSP RDLKKCYSVE
2260 2270 2280 2290 2300
AQSCQRRPTS WLDEQRRHSI AVSCLDSGSQ PHLGTDPSNL GGQPLGGPGS
2310 2320 2330 2340 2350
RPKKKLSPPS ITIDPPESQG PRTPPSPGIC LRRRAPSSDS KDPLASGPPD
2360 2370
SMAASPSPKK DVLSLSGLSS DPADLDP
Length:2,377
Mass (Da):262,472
Last modified:December 1, 2000 - v3
Checksum:i1C9F7C557D9D32DF
GO
Isoform 1 (identifier: O43497-2) [UniParc]FASTAAdd to Basket

Also known as: Variant 89

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Show »
Length:2,250
Mass (Da):249,333
Checksum:iACDCB167AA5DF18F
GO
Isoform 2 (identifier: O43497-3) [UniParc]FASTAAdd to Basket

Also known as: Variant 25

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1587: NLMLDDVIASGSSASAASE → K
     1928-2020: Missing.

Show »
Length:2,243
Mass (Da):248,529
Checksum:i74FA50071A5F9FBD
GO
Isoform 3 (identifier: O43497-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.

Show »
Length:2,354
Mass (Da):260,029
Checksum:i2F13189AF179C9E2
GO
Isoform 4 (identifier: O43497-5) [UniParc]FASTAAdd to Basket

Also known as: Variant 88

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.
     2156-2234: Missing.

Show »
Length:2,171
Mass (Da):240,920
Checksum:i1C5BEDD83C1C8FB7
GO
Isoform 6 (identifier: O43497-6) [UniParc]FASTAAdd to Basket

Also known as: Variant 217

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Show »
Length:2,273
Mass (Da):251,776
Checksum:iBBE93AF4CCAC8F8D
GO
Isoform 7 (identifier: O43497-7) [UniParc]FASTAAdd to Basket

Also known as: Variant 221

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1976-2020: Missing.

Show »
Length:2,321
Mass (Da):256,828
Checksum:i2051A97223D0081D
GO
Isoform 8 (identifier: O43497-8) [UniParc]FASTAAdd to Basket

Also known as: Variant 93

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1976-2020: Missing.

Show »
Length:2,298
Mass (Da):254,386
Checksum:iEF51D26EC38F66F8
GO
Isoform 9 (identifier: O43497-9) [UniParc]FASTAAdd to Basket

Also known as: Variant 57

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1928-2020: Missing.

Show »
Length:2,261
Mass (Da):250,221
Checksum:iDCA090B5433D83E1
GO
Isoform 10 (identifier: O43497-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1928-1975: Missing.

Show »
Length:2,306
Mass (Da):254,976
Checksum:i943D153CFCC75CF8
GO
Isoform 11 (identifier: O43497-11) [UniParc]FASTAAdd to Basket

Also known as: Variant 185

The sequence of this isoform differs from the canonical sequence as follows:
     1928-2020: Missing.

Show »
Length:2,284
Mass (Da):252,664
Checksum:iFCB59420799A126E
GO
Isoform 12 (identifier: O43497-12) [UniParc]FASTAAdd to Basket

Also known as: Variant 189

The sequence of this isoform differs from the canonical sequence as follows:
     1976-2020: Missing.

Show »
Length:2,332
Mass (Da):257,716
Checksum:i74F41CEA601E8CBC
GO
Isoform 13 (identifier: O43497-13) [UniParc]FASTAAdd to Basket

Also known as: Variant 153

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1928-2020: Missing.

Show »
Length:2,266
Mass (Da):250,972
Checksum:i66E3563375ED61DA
GO
Isoform 14 (identifier: O43497-15) [UniParc]FASTAAdd to Basket

Also known as: Variant 137

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1737-1743: Missing.
     1928-2020: Missing.

Show »
Length:2,259
Mass (Da):250,204
Checksum:i4DB0EDC2873FB788
GO
Isoform 15 (identifier: O43497-16) [UniParc]FASTAAdd to Basket

Also known as: Variant 157

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1976-2020: Missing.

Show »
Length:2,314
Mass (Da):256,024
Checksum:i8C9D69B5A3C86C21
GO
Isoform 16 (identifier: O43497-17) [UniParc]FASTAAdd to Basket

Also known as: Variant 169

The sequence of this isoform differs from the canonical sequence as follows:
     1737-1743: Missing.
     1928-2020: Missing.

Show »
Length:2,277
Mass (Da):251,896
Checksum:iB942CD535E125104
GO
Isoform 17 (identifier: O43497-18) [UniParc]FASTAAdd to Basket

Also known as: Variant 184

The sequence of this isoform differs from the canonical sequence as follows:
     1928-2020: Missing.
     2156-2234: Missing.

Show »
Length:2,205
Mass (Da):244,250
Checksum:iE059BCB89C6929DA
GO
Isoform 18 (identifier: O43497-19) [UniParc]FASTAAdd to Basket

Also known as: Variant 216

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.
     2156-2234: Missing.

Show »
Length:2,194
Mass (Da):243,362
Checksum:i1A2CC9E24EDDECA1
GO
Isoform 19 (identifier: O43497-20) [UniParc]FASTAAdd to Basket

Also known as: Variant 223

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA

Show »
Length:2,366
Mass (Da):261,584
Checksum:i2CBDED941FB8B793
GO
Isoform 20 (identifier: O43497-21) [UniParc]FASTAAdd to Basket

Also known as: Variant 249

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1569: N → SKEKQMAD
     1928-2020: Missing.

Show »
Length:2,291
Mass (Da):253,467
Checksum:i031D1E0372857147
GO
Isoform 21 (identifier: O43497-22) [UniParc]FASTAAdd to Basket

Also known as: Variant 313

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1505-1538: Missing.
     1928-2020: Missing.

Show »
Length:2,227
Mass (Da):246,224
Checksum:iE0F263D2479502B0
GO
Isoform 22 (identifier: O43497-23) [UniParc]FASTAAdd to Basket

Also known as: Variant 409

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1569-1587: NLMLDDVIASGSSASAASE → K
     1928-2020: Missing.

Show »
Length:2,232
Mass (Da):246,975
Checksum:iCC32AACAC448BE1A
GO
Isoform 23 (identifier: O43497-24) [UniParc]FASTAAdd to Basket

Also known as: Variant 441

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1928-2020: Missing.

Show »
Length:2,250
Mass (Da):248,667
Checksum:i3196A2446C52D0D5
GO
Isoform 24 (identifier: O43497-25) [UniParc]FASTAAdd to Basket

Also known as: Variant 477

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1976-2020: Missing.

Show »
Length:2,287
Mass (Da):252,831
Checksum:i38379DC69AAACA57
GO
Isoform 25 (identifier: O43497-26) [UniParc]FASTAAdd to Basket

Also known as: Variant 473

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Show »
Length:2,239
Mass (Da):247,779
Checksum:i15CBEF30957AAB27
GO
Isoform 26 (identifier: O43497-27) [UniParc]FASTAAdd to Basket

Also known as: Variant 17

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1587: NLMLDDVIASGSSASAASE → K
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.

Show »
Length:1,735
Mass (Da):194,084
Checksum:iF8C3FE1FDB00B3A8
GO
Isoform 27 (identifier: O43497-28) [UniParc]FASTAAdd to Basket

Also known as: Variant 33

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1736-1769: VMQALPQVGNLGLLFMLLFFIFAALGVELFGDLE → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1770-2377: Missing.

Show »
Length:1,746
Mass (Da):195,008
Checksum:iF7562C646DF6275D
GO
Isoform 28 (identifier: O43497-29) [UniParc]FASTAAdd to Basket

Also known as: Variant 49

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.

Show »
Length:1,753
Mass (Da):195,776
Checksum:i0A6D75AA5418BCCA
GO
Isoform 29 (identifier: O43497-30) [UniParc]FASTAAdd to Basket

Also known as: Variant 145

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.

Show »
Length:1,758
Mass (Da):196,527
Checksum:i79746C4F53C48A96
GO
Isoform 30 (identifier: O43497-31) [UniParc]FASTAAdd to Basket

Also known as: Variant 177

The sequence of this isoform differs from the canonical sequence as follows:
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.

Show »
Length:1,776
Mass (Da):198,218
Checksum:i8A58FF574B070494
GO
Isoform 31 (identifier: O43497-32) [UniParc]FASTAAdd to Basket

Also known as: Variant 209

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.

Show »
Length:1,765
Mass (Da):197,330
Checksum:iC26247C1EAE03CFE
GO
Isoform 32 (identifier: O43497-33) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA

Note: Gene prediction based on EST data.

Show »
Length:2,343
Mass (Da):259,141
Checksum:i01E1315F5E43FF9C
GO
Isoform 33 (identifier: O43497-34) [UniParc]FASTAAdd to Basket

Also known as: Variant 441-d81

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1531: Missing.
     1928-2020: Missing.

Show »
Length:2,257
Mass (Da):249,396
Checksum:i7271F3B05E9438BA
GO
Isoform 34 (identifier: O43497-35) [UniParc]FASTAAdd to Basket

Also known as: Variant 473-d75

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1529: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Show »
Length:2,248
Mass (Da):248,754
Checksum:i302BC6EC72A65A1F
GO
Isoform 35 (identifier: O43497-36) [UniParc]FASTAAdd to Basket

Also known as: Variant 473-d81

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1531: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Show »
Length:2,246
Mass (Da):248,509
Checksum:iF99DA2229E40387E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1345 – 13451S → I in AAD12731. (PubMed:9495342)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei971 – 99323Missing in isoform 1, isoform 2, isoform 3, isoform 4, isoform 8, isoform 9, isoform 10, isoform 21, isoform 26, isoform 27, isoform 28 and isoform 32. 4 PublicationsVSP_000940Add
BLAST
Alternative sequencei1505 – 153834Missing in isoform 21, isoform 22, isoform 23, isoform 24 and isoform 25. 1 PublicationVSP_047545Add
BLAST
Alternative sequencei1505 – 153127Missing in isoform 33 and isoform 35. 1 PublicationVSP_047546Add
BLAST
Alternative sequencei1505 – 152925Missing in isoform 34. 1 PublicationVSP_047547Add
BLAST
Alternative sequencei1569 – 158719NLMLD…SAASE → K in isoform 2, isoform 13, isoform 14, isoform 15, isoform 22, isoform 26 and isoform 29. 2 PublicationsVSP_000944Add
BLAST
Alternative sequencei1569 – 158618NLMLD…ASAAS → SKEKQMA in isoform 1, isoform 4, isoform 6, isoform 7, isoform 8, isoform 18, isoform 19, isoform 24, isoform 25, isoform 31, isoform 32, isoform 34 and isoform 35. 2 PublicationsVSP_000943Add
BLAST
Alternative sequencei1569 – 15691N → SKEKQMAD in isoform 20. 1 PublicationVSP_047548
Alternative sequencei1736 – 176934VMQAL…FGDLE → LWAWSSLETWSVTRHTPVRA WAVMPPFGTLAWPS in isoform 27. 1 PublicationVSP_047549Add
BLAST
Alternative sequencei1737 – 17437Missing in isoform 14 and isoform 16. 1 PublicationVSP_047550
Alternative sequencei1743 – 177634VGNLG…ETHPC → LWAWSSLETWSVTRHTPVRA WAVMPPFGTLAWPS in isoform 26, isoform 28, isoform 29, isoform 30 and isoform 31. 1 PublicationVSP_047551Add
BLAST
Alternative sequencei1770 – 2377608Missing in isoform 27. 1 PublicationVSP_047552Add
BLAST
Alternative sequencei1777 – 2377601Missing in isoform 26, isoform 28, isoform 29, isoform 30 and isoform 31. 1 PublicationVSP_047553Add
BLAST
Alternative sequencei1928 – 202093Missing in isoform 1, isoform 2, isoform 4, isoform 6, isoform 9, isoform 11, isoform 13, isoform 14, isoform 16, isoform 17, isoform 18, isoform 20, isoform 21, isoform 22, isoform 23, isoform 25, isoform 33, isoform 34 and isoform 35. 4 PublicationsVSP_000946Add
BLAST
Alternative sequencei1928 – 197548Missing in isoform 10. CuratedVSP_000945Add
BLAST
Alternative sequencei1976 – 202045Missing in isoform 7, isoform 8, isoform 12, isoform 15 and isoform 24. 1 PublicationVSP_000947Add
BLAST
Alternative sequencei2156 – 223479Missing in isoform 4, isoform 17 and isoform 18. 1 PublicationVSP_000948Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF124351 mRNA. Translation: AAD34352.1.
AF134985 mRNA. Translation: AAF19346.1.
AF134986 mRNA. Translation: AAF19347.1.
AF190860 mRNA. Translation: AAF35287.1.
AF126965 mRNA. Translation: AAD29400.1.
AF126966 mRNA. Translation: AAD29401.1.
AF227744 mRNA. Translation: AAF37689.1.
AF227745 mRNA. Translation: AAF37690.1.
AF227746 mRNA. Translation: AAF37691.1.
AF227747 mRNA. Translation: AAF37692.1.
AF227748 mRNA. Translation: AAF37693.1.
AF227749 mRNA. Translation: AAF37694.1.
AF227750 mRNA. Translation: AAF37695.1.
AF227751 mRNA. Translation: AAF37696.1.
DQ494449 mRNA. Translation: ABF69900.1.
DQ494450 mRNA. Translation: ABF69901.1.
DQ494451 mRNA. Translation: ABF69902.1.
DQ494452 mRNA. Translation: ABF69903.1.
DQ494453 mRNA. Translation: ABF69904.1.
DQ494454 mRNA. Translation: ABF69905.1.
DQ494455 mRNA. Translation: ABF69906.1.
DQ494456 mRNA. Translation: ABF69907.1.
DQ494457 mRNA. Translation: ABF69908.1.
DQ494458 mRNA. Translation: ABF69909.1.
DQ494459 mRNA. Translation: ABF69910.1.
DQ494460 mRNA. Translation: ABF69911.1.
DQ494461 mRNA. Translation: ABF69912.1.
DQ494462 mRNA. Translation: ABF69913.1.
DQ494463 mRNA. Translation: ABF69914.1.
DQ494464 mRNA. Translation: ABF69915.1.
DQ494465 mRNA. Translation: ABF69916.1.
DQ494466 mRNA. Translation: ABF69917.1.
DQ494467 mRNA. Translation: ABF69918.1.
DQ494468 mRNA. Translation: ABF69919.1.
DQ494469 mRNA. Translation: ABF69920.1.
DQ494470 mRNA. Translation: ABF69921.1.
DQ494471 mRNA. Translation: ABF69922.1.
DQ494472 mRNA. Translation: ABF69923.1.
DQ494473 mRNA. Translation: ABF69924.1.
DQ494474 mRNA. Translation: ABF69925.1.
DQ494475 mRNA. Translation: ABF69926.1.
DQ494476 mRNA. Translation: ABF69927.1.
DQ494477 mRNA. Translation: ABF69928.1.
DQ494478 mRNA. Translation: ABF69929.1.
DQ494479 mRNA. Translation: ABF69930.1.
AC004590 Genomic DNA. No translation available.
AC021491 Genomic DNA. No translation available.
BC110995 mRNA. Translation: AAI10996.1.
AB032949 mRNA. Translation: BAA86437.2.
AF029228 mRNA. Translation: AAD12731.1.
AF029229 mRNA. Translation: AAD12732.1.
CCDSiCCDS45730.1. [O43497-1]
CCDS45731.1. [O43497-12]
CCDS45732.1. [O43497-11]
CCDS45733.1. [O43497-13]
CCDS45734.1. [O43497-33]
CCDS45735.1. [O43497-2]
CCDS45736.1. [O43497-5]
CCDS45737.1. [O43497-10]
CCDS54142.1. [O43497-7]
CCDS54143.1. [O43497-6]
CCDS54144.1. [O43497-9]
CCDS54145.1. [O43497-3]
CCDS54146.1. [O43497-8]
CCDS58565.1. [O43497-17]
CCDS58566.1. [O43497-18]
CCDS58567.1. [O43497-15]
CCDS58568.1. [O43497-16]
CCDS58569.1. [O43497-21]
CCDS58570.1. [O43497-20]
CCDS58571.1. [O43497-19]
CCDS58572.1. [O43497-24]
CCDS58573.1. [O43497-23]
CCDS58574.1. [O43497-25]
CCDS58575.1. [O43497-26]
CCDS58576.1. [O43497-22]
RefSeqiNP_001243253.1. NM_001256324.1. [O43497-16]
NP_001243254.1. NM_001256325.1. [O43497-21]
NP_001243255.1. NM_001256326.1. [O43497-25]
NP_001243256.1. NM_001256327.1. [O43497-17]
NP_001243257.1. NM_001256328.1. [O43497-15]
NP_001243258.1. NM_001256329.1. [O43497-24]
NP_001243259.1. NM_001256330.1. [O43497-26]
NP_001243260.1. NM_001256331.1. [O43497-23]
NP_001243261.1. NM_001256332.1. [O43497-22]
NP_001243262.1. NM_001256333.1. [O43497-18]
NP_001243263.1. NM_001256334.1. [O43497-19]
NP_001243288.1. NM_001256359.1. [O43497-34]
NP_001243289.1. NM_001256360.1. [O43497-35]
NP_001243290.1. NM_001256361.1. [O43497-36]
NP_061496.2. NM_018896.4. [O43497-1]
NP_938190.1. NM_198376.2. [O43497-5]
NP_938191.2. NM_198377.2. [O43497-20]
NP_938192.1. NM_198378.2. [O43497-6]
NP_938193.1. NM_198379.2. [O43497-8]
NP_938194.1. NM_198380.2. [O43497-7]
NP_938196.1. NM_198382.2. [O43497-9]
NP_938197.1. NM_198383.2. [O43497-10]
NP_938198.1. NM_198384.2. [O43497-11]
NP_938199.1. NM_198385.2. [O43497-12]
NP_938200.1. NM_198386.2. [O43497-13]
NP_938201.1. NM_198387.2. [O43497-2]
NP_938202.1. NM_198388.2. [O43497-3]
NP_938406.1. NM_198396.2. [O43497-33]
UniGeneiHs.591169.

Genome annotation databases

EnsembliENST00000352832; ENSP00000339302; ENSG00000006283. [O43497-2]
ENST00000354983; ENSP00000347078; ENSG00000006283. [O43497-33]
ENST00000358244; ENSP00000350979; ENSG00000006283. [O43497-5]
ENST00000359106; ENSP00000352011; ENSG00000006283. [O43497-1]
ENST00000360761; ENSP00000353990; ENSG00000006283. [O43497-9]
ENST00000429973; ENSP00000414388; ENSG00000006283. [O43497-13]
ENST00000442258; ENSP00000409759; ENSG00000006283. [O43497-3]
ENST00000502264; ENSP00000425522; ENSG00000006283. [O43497-10]
ENST00000503436; ENSP00000427231; ENSG00000006283. [O43497-29]
ENST00000503485; ENSP00000427238; ENSG00000006283. [O43497-24]
ENST00000503607; ENSP00000426558; ENSG00000006283. [O43497-27]
ENST00000504076; ENSP00000425153; ENSG00000006283. [O43497-32]
ENST00000505165; ENSP00000422268; ENSG00000006283. [O43497-18]
ENST00000506406; ENSP00000426313; ENSG00000006283. [O43497-31]
ENST00000507336; ENSP00000420918; ENSG00000006283. [O43497-20]
ENST00000507510; ENSP00000423112; ENSG00000006283. [O43497-12]
ENST00000507609; ENSP00000423045; ENSG00000006283. [O43497-17]
ENST00000507896; ENSP00000421518; ENSG00000006283. [O43497-19]
ENST00000510115; ENSP00000427173; ENSG00000006283. [O43497-8]
ENST00000510366; ENSP00000426814; ENSG00000006283. [O43497-23]
ENST00000511765; ENSP00000427247; ENSG00000006283. [O43497-30]
ENST00000511768; ENSP00000424664; ENSG00000006283. [O43497-28]
ENST00000512389; ENSP00000426261; ENSG00000006283. [O43497-6]
ENST00000513689; ENSP00000426172; ENSG00000006283. [O43497-25]
ENST00000513964; ENSP00000425451; ENSG00000006283. [O43497-26]
ENST00000514079; ENSP00000423317; ENSG00000006283. [O43497-21]
ENST00000514181; ENSP00000425698; ENSG00000006283. [O43497-15]
ENST00000514717; ENSP00000422407; ENSG00000006283. [O43497-22]
ENST00000515165; ENSP00000426098; ENSG00000006283. [O43497-11]
ENST00000515411; ENSP00000423155; ENSG00000006283. [O43497-16]
ENST00000515765; ENSP00000426232; ENSG00000006283. [O43497-7]
GeneIDi8913.
KEGGihsa:8913.
UCSCiuc002irk.2. human. [O43497-1]
uc002irl.2. human.
uc002iru.2. human.
uc002irw.2. human. [O43497-10]
uc002irx.2. human.
uc002iry.2. human.
uc002irz.2. human.
uc002isa.2. human.
uc002isb.2. human.
uc002isd.2. human.
uc002ise.2. human.
uc002isf.2. human.
uc002isg.2. human.
uc002ish.2. human.
uc002isi.2. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF124351 mRNA. Translation: AAD34352.1 .
AF134985 mRNA. Translation: AAF19346.1 .
AF134986 mRNA. Translation: AAF19347.1 .
AF190860 mRNA. Translation: AAF35287.1 .
AF126965 mRNA. Translation: AAD29400.1 .
AF126966 mRNA. Translation: AAD29401.1 .
AF227744 mRNA. Translation: AAF37689.1 .
AF227745 mRNA. Translation: AAF37690.1 .
AF227746 mRNA. Translation: AAF37691.1 .
AF227747 mRNA. Translation: AAF37692.1 .
AF227748 mRNA. Translation: AAF37693.1 .
AF227749 mRNA. Translation: AAF37694.1 .
AF227750 mRNA. Translation: AAF37695.1 .
AF227751 mRNA. Translation: AAF37696.1 .
DQ494449 mRNA. Translation: ABF69900.1 .
DQ494450 mRNA. Translation: ABF69901.1 .
DQ494451 mRNA. Translation: ABF69902.1 .
DQ494452 mRNA. Translation: ABF69903.1 .
DQ494453 mRNA. Translation: ABF69904.1 .
DQ494454 mRNA. Translation: ABF69905.1 .
DQ494455 mRNA. Translation: ABF69906.1 .
DQ494456 mRNA. Translation: ABF69907.1 .
DQ494457 mRNA. Translation: ABF69908.1 .
DQ494458 mRNA. Translation: ABF69909.1 .
DQ494459 mRNA. Translation: ABF69910.1 .
DQ494460 mRNA. Translation: ABF69911.1 .
DQ494461 mRNA. Translation: ABF69912.1 .
DQ494462 mRNA. Translation: ABF69913.1 .
DQ494463 mRNA. Translation: ABF69914.1 .
DQ494464 mRNA. Translation: ABF69915.1 .
DQ494465 mRNA. Translation: ABF69916.1 .
DQ494466 mRNA. Translation: ABF69917.1 .
DQ494467 mRNA. Translation: ABF69918.1 .
DQ494468 mRNA. Translation: ABF69919.1 .
DQ494469 mRNA. Translation: ABF69920.1 .
DQ494470 mRNA. Translation: ABF69921.1 .
DQ494471 mRNA. Translation: ABF69922.1 .
DQ494472 mRNA. Translation: ABF69923.1 .
DQ494473 mRNA. Translation: ABF69924.1 .
DQ494474 mRNA. Translation: ABF69925.1 .
DQ494475 mRNA. Translation: ABF69926.1 .
DQ494476 mRNA. Translation: ABF69927.1 .
DQ494477 mRNA. Translation: ABF69928.1 .
DQ494478 mRNA. Translation: ABF69929.1 .
DQ494479 mRNA. Translation: ABF69930.1 .
AC004590 Genomic DNA. No translation available.
AC021491 Genomic DNA. No translation available.
BC110995 mRNA. Translation: AAI10996.1 .
AB032949 mRNA. Translation: BAA86437.2 .
AF029228 mRNA. Translation: AAD12731.1 .
AF029229 mRNA. Translation: AAD12732.1 .
CCDSi CCDS45730.1. [O43497-1 ]
CCDS45731.1. [O43497-12 ]
CCDS45732.1. [O43497-11 ]
CCDS45733.1. [O43497-13 ]
CCDS45734.1. [O43497-33 ]
CCDS45735.1. [O43497-2 ]
CCDS45736.1. [O43497-5 ]
CCDS45737.1. [O43497-10 ]
CCDS54142.1. [O43497-7 ]
CCDS54143.1. [O43497-6 ]
CCDS54144.1. [O43497-9 ]
CCDS54145.1. [O43497-3 ]
CCDS54146.1. [O43497-8 ]
CCDS58565.1. [O43497-17 ]
CCDS58566.1. [O43497-18 ]
CCDS58567.1. [O43497-15 ]
CCDS58568.1. [O43497-16 ]
CCDS58569.1. [O43497-21 ]
CCDS58570.1. [O43497-20 ]
CCDS58571.1. [O43497-19 ]
CCDS58572.1. [O43497-24 ]
CCDS58573.1. [O43497-23 ]
CCDS58574.1. [O43497-25 ]
CCDS58575.1. [O43497-26 ]
CCDS58576.1. [O43497-22 ]
RefSeqi NP_001243253.1. NM_001256324.1. [O43497-16 ]
NP_001243254.1. NM_001256325.1. [O43497-21 ]
NP_001243255.1. NM_001256326.1. [O43497-25 ]
NP_001243256.1. NM_001256327.1. [O43497-17 ]
NP_001243257.1. NM_001256328.1. [O43497-15 ]
NP_001243258.1. NM_001256329.1. [O43497-24 ]
NP_001243259.1. NM_001256330.1. [O43497-26 ]
NP_001243260.1. NM_001256331.1. [O43497-23 ]
NP_001243261.1. NM_001256332.1. [O43497-22 ]
NP_001243262.1. NM_001256333.1. [O43497-18 ]
NP_001243263.1. NM_001256334.1. [O43497-19 ]
NP_001243288.1. NM_001256359.1. [O43497-34 ]
NP_001243289.1. NM_001256360.1. [O43497-35 ]
NP_001243290.1. NM_001256361.1. [O43497-36 ]
NP_061496.2. NM_018896.4. [O43497-1 ]
NP_938190.1. NM_198376.2. [O43497-5 ]
NP_938191.2. NM_198377.2. [O43497-20 ]
NP_938192.1. NM_198378.2. [O43497-6 ]
NP_938193.1. NM_198379.2. [O43497-8 ]
NP_938194.1. NM_198380.2. [O43497-7 ]
NP_938196.1. NM_198382.2. [O43497-9 ]
NP_938197.1. NM_198383.2. [O43497-10 ]
NP_938198.1. NM_198384.2. [O43497-11 ]
NP_938199.1. NM_198385.2. [O43497-12 ]
NP_938200.1. NM_198386.2. [O43497-13 ]
NP_938201.1. NM_198387.2. [O43497-2 ]
NP_938202.1. NM_198388.2. [O43497-3 ]
NP_938406.1. NM_198396.2. [O43497-33 ]
UniGenei Hs.591169.

3D structure databases

ProteinModelPortali O43497.
SMRi O43497. Positions 82-234, 745-976, 1278-1549, 1617-1863.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114427. 1 interaction.
IntActi O43497. 2 interactions.
MINTi MINT-2796172.

Chemistry

BindingDBi O43497.
ChEMBLi CHEMBL2362995.
DrugBanki DB00568. Cinnarizine.
DB00593. Ethosuximide.
DB04841. Flunarizine.
DB05246. Methsuximide.
DB00421. Spironolactone.
DB00347. Trimethadione.
DB00661. Verapamil.
DB00909. Zonisamide.
GuidetoPHARMACOLOGYi 535.

PTM databases

PhosphoSitei O43497.

Proteomic databases

PaxDbi O43497.
PRIDEi O43497.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000352832 ; ENSP00000339302 ; ENSG00000006283 . [O43497-2 ]
ENST00000354983 ; ENSP00000347078 ; ENSG00000006283 . [O43497-33 ]
ENST00000358244 ; ENSP00000350979 ; ENSG00000006283 . [O43497-5 ]
ENST00000359106 ; ENSP00000352011 ; ENSG00000006283 . [O43497-1 ]
ENST00000360761 ; ENSP00000353990 ; ENSG00000006283 . [O43497-9 ]
ENST00000429973 ; ENSP00000414388 ; ENSG00000006283 . [O43497-13 ]
ENST00000442258 ; ENSP00000409759 ; ENSG00000006283 . [O43497-3 ]
ENST00000502264 ; ENSP00000425522 ; ENSG00000006283 . [O43497-10 ]
ENST00000503436 ; ENSP00000427231 ; ENSG00000006283 . [O43497-29 ]
ENST00000503485 ; ENSP00000427238 ; ENSG00000006283 . [O43497-24 ]
ENST00000503607 ; ENSP00000426558 ; ENSG00000006283 . [O43497-27 ]
ENST00000504076 ; ENSP00000425153 ; ENSG00000006283 . [O43497-32 ]
ENST00000505165 ; ENSP00000422268 ; ENSG00000006283 . [O43497-18 ]
ENST00000506406 ; ENSP00000426313 ; ENSG00000006283 . [O43497-31 ]
ENST00000507336 ; ENSP00000420918 ; ENSG00000006283 . [O43497-20 ]
ENST00000507510 ; ENSP00000423112 ; ENSG00000006283 . [O43497-12 ]
ENST00000507609 ; ENSP00000423045 ; ENSG00000006283 . [O43497-17 ]
ENST00000507896 ; ENSP00000421518 ; ENSG00000006283 . [O43497-19 ]
ENST00000510115 ; ENSP00000427173 ; ENSG00000006283 . [O43497-8 ]
ENST00000510366 ; ENSP00000426814 ; ENSG00000006283 . [O43497-23 ]
ENST00000511765 ; ENSP00000427247 ; ENSG00000006283 . [O43497-30 ]
ENST00000511768 ; ENSP00000424664 ; ENSG00000006283 . [O43497-28 ]
ENST00000512389 ; ENSP00000426261 ; ENSG00000006283 . [O43497-6 ]
ENST00000513689 ; ENSP00000426172 ; ENSG00000006283 . [O43497-25 ]
ENST00000513964 ; ENSP00000425451 ; ENSG00000006283 . [O43497-26 ]
ENST00000514079 ; ENSP00000423317 ; ENSG00000006283 . [O43497-21 ]
ENST00000514181 ; ENSP00000425698 ; ENSG00000006283 . [O43497-15 ]
ENST00000514717 ; ENSP00000422407 ; ENSG00000006283 . [O43497-22 ]
ENST00000515165 ; ENSP00000426098 ; ENSG00000006283 . [O43497-11 ]
ENST00000515411 ; ENSP00000423155 ; ENSG00000006283 . [O43497-16 ]
ENST00000515765 ; ENSP00000426232 ; ENSG00000006283 . [O43497-7 ]
GeneIDi 8913.
KEGGi hsa:8913.
UCSCi uc002irk.2. human. [O43497-1 ]
uc002irl.2. human.
uc002iru.2. human.
uc002irw.2. human. [O43497-10 ]
uc002irx.2. human.
uc002iry.2. human.
uc002irz.2. human.
uc002isa.2. human.
uc002isb.2. human.
uc002isd.2. human.
uc002ise.2. human.
uc002isf.2. human.
uc002isg.2. human.
uc002ish.2. human.
uc002isi.2. human.

Organism-specific databases

CTDi 8913.
GeneCardsi GC17P048639.
HGNCi HGNC:1394. CACNA1G.
HPAi HPA004714.
MIMi 604065. gene.
neXtProti NX_O43497.
PharmGKBi PA381.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1226.
GeneTreei ENSGT00760000118827.
HOVERGENi HBG050764.
InParanoidi O43497.
KOi K04854.
OMAi QRCRILQ.
OrthoDBi EOG7MKW55.
PhylomeDBi O43497.
TreeFami TF313555.

Enzyme and pathway databases

Reactomei REACT_18312. NCAM1 interactions.

Miscellaneous databases

ChiTaRSi CACNA1G. human.
GeneWikii CACNA1G.
GenomeRNAii 8913.
NextBioi 33500.
PROi O43497.
SOURCEi Search...

Gene expression databases

Bgeei O43497.
ExpressionAtlasi O43497. baseline and differential.
Genevestigatori O43497.

Family and domain databases

Gene3Di 1.20.120.350. 4 hits.
InterProi IPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR005445. VDCC_T_a1su.
IPR002077. VDCCAlpha1.
[Graphical view ]
Pfami PF00520. Ion_trans. 4 hits.
[Graphical view ]
PRINTSi PR00167. CACHANNEL.
PR01629. TVDCCALPHA1.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Inactivation of CACNA1G, a T-type calcium channel gene, by aberrant methylation of its 5' CpG island in human tumors."
    Toyota M., Ho C., Ohe-Toyota M., Baylin S.B., Issa J.-P.J.
    Cancer Res. 59:4535-4541(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), GENE STRUCTURE.
    Tissue: Prostatic carcinoma.
  2. "Structure and alternative splicing of the gene encoding alpha1G, a human brain T calcium channel alpha1 subunit."
    Mittman S., Guo J., Agnew W.S.
    Neurosci. Lett. 274:143-146(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS 4 AND 5).
    Tissue: Brain.
  3. "Molecular cloning and functional expression of ca(v)3.1c, a T-type calcium channel from human brain."
    Cribbs L.L., Gomora J.C., Daud A.N., Lee J.-H., Perez-Reyes E.
    FEBS Lett. 466:54-58(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "Molecular and functional properties of the human alpha1G subunit that forms T-type calcium channels."
    Monteil A., Chemin J., Bourinet E., Mennessier G., Lory P., Nargeot J.
    J. Biol. Chem. 275:6090-6100(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS 1-2 AND 6-13).
    Tissue: Brain.
  5. "Profiling the array of Ca(v)3.1 variants from the human T-type calcium channel gene CACNA1G: alternative structures, developmental expression, and biophysical variations."
    Emerick M.C., Stein R., Kunze R., McNulty M.M., Regan M.R., Hanck D.A., Agnew W.S.
    Proteins 64:320-342(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4; 6; 7; 8; 9; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20; 21; 22; 23; 24; 25; 26; 27; 28; 29; 30; 31; 33; 34 AND 35), DEVELOPMENTAL STAGE.
    Tissue: Brain and Fetal brain.
  6. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9).
  8. "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
    Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
    DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 550-2377 (ISOFORM 13).
    Tissue: Brain.
  9. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  10. "Molecular characterization of a neuronal low-voltage-activated T-type calcium channel."
    Perez-Reyes E., Cribbs L.L., Daud A., Lacerda A.E., Barclay J., Williamson M.P., Fox M., Rees M., Lee J.-H.
    Nature 391:896-900(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1126-1444; 1778-1927 AND 2021-2312.
    Tissue: Brain.

Entry informationi

Entry nameiCAC1G_HUMAN
AccessioniPrimary (citable) accession number: O43497
Secondary accession number(s): D6RA64
, E7EPR0, O43498, O94770, Q19QY8, Q19QY9, Q19QZ0, Q19QZ1, Q19QZ2, Q19QZ3, Q19QZ4, Q19QZ5, Q19QZ6, Q19QZ7, Q19QZ8, Q19QZ9, Q19R00, Q19R01, Q19R02, Q19R03, Q19R04, Q19R05, Q19R06, Q19R07, Q19R08, Q19R09, Q19R10, Q19R11, Q19R12, Q19R13, Q19R15, Q19R16, Q19R17, Q19R18, Q2TAC4, Q9NYU4, Q9NYU5, Q9NYU6, Q9NYU7, Q9NYU8, Q9NYU9, Q9NYV0, Q9NYV1, Q9UHN9, Q9UHP0, Q9ULU6, Q9UNG7, Q9Y5T2, Q9Y5T3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: December 1, 2000
Last modified: November 26, 2014
This is version 132 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3