SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O43497

- CAC1G_HUMAN

UniProt

O43497 - CAC1G_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Voltage-dependent T-type calcium channel subunit alpha-1G
Gene
CACNA1G, KIAA1123
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1G gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by mibefradil. A particularity of this type of channel is an opening at quite negative potentials and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei354 – 3541Calcium ion selectivity and permeability By similarity
Sitei924 – 9241Calcium ion selectivity and permeability By similarity
Sitei1465 – 14651Calcium ion selectivity and permeability By similarity
Sitei1770 – 17701Calcium ion selectivity and permeability By similarity

GO - Molecular functioni

  1. low voltage-gated calcium channel activity Source: BHF-UCL
  2. scaffold protein binding Source: BHF-UCL

GO - Biological processi

  1. axon guidance Source: Reactome
  2. calcium ion import Source: BHF-UCL
  3. membrane depolarization during action potential Source: RefGenome
  4. positive regulation of calcium ion-dependent exocytosis Source: RefGenome
  5. regulation of atrial cardiac muscle cell membrane depolarization Source: Ensembl
  6. regulation of heart rate Source: Ensembl
  7. regulation of membrane potential Source: BHF-UCL
  8. response to nickel cation Source: Ensembl
  9. synaptic transmission Source: Ensembl
  10. transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_18312. NCAM1 interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent T-type calcium channel subunit alpha-1G
Alternative name(s):
Cav3.1c
NBR13
Voltage-gated calcium channel subunit alpha Cav3.1
Gene namesi
Name:CACNA1G
Synonyms:KIAA1123
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:1394. CACNA1G.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 8080Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei81 – 10121Helical; Name=S1 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini102 – 11918Extracellular Reviewed prediction
Add
BLAST
Transmembranei120 – 14122Helical; Name=S2 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini142 – 1509Cytoplasmic Reviewed prediction
Transmembranei151 – 17020Helical; Name=S3 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini171 – 1755Extracellular Reviewed prediction
Transmembranei176 – 19318Helical; Name=S4 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini194 – 21320Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei214 – 23421Helical; Name=S5 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini235 – 370136Extracellular Reviewed prediction
Add
BLAST
Transmembranei371 – 39525Helical; Name=S6 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini396 – 743348Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei744 – 76421Helical; Name=S1 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini765 – 77713Extracellular Reviewed prediction
Add
BLAST
Transmembranei778 – 79922Helical; Name=S2 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini800 – 8056Cytoplasmic Reviewed prediction
Transmembranei806 – 82419Helical; Name=S3 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini825 – 8328Extracellular Reviewed prediction
Transmembranei833 – 85624Helical; Name=S4 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini857 – 86711Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei868 – 88821Helical; Name=S5 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini889 – 93951Extracellular Reviewed prediction
Add
BLAST
Transmembranei940 – 96425Helical; Name=S6 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini965 – 1272308Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei1273 – 129523Helical; Name=S1 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1296 – 131318Extracellular Reviewed prediction
Add
BLAST
Transmembranei1314 – 133421Helical; Name=S2 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1335 – 134410Cytoplasmic Reviewed prediction
Transmembranei1345 – 136420Helical; Name=S3 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1365 – 137814Extracellular Reviewed prediction
Add
BLAST
Transmembranei1379 – 140022Helical; Name=S4 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1401 – 141010Cytoplasmic Reviewed prediction
Transmembranei1411 – 143424Helical; Name=S5 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1435 – 151177Extracellular Reviewed prediction
Add
BLAST
Transmembranei1512 – 153726Helical; Name=S6 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1538 – 161073Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei1611 – 163121Helical; Name=S1 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1632 – 164514Extracellular Reviewed prediction
Add
BLAST
Transmembranei1646 – 166722Helical; Name=S2 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1668 – 16747Cytoplasmic Reviewed prediction
Transmembranei1675 – 169319Helical; Name=S3 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1694 – 170714Extracellular Reviewed prediction
Add
BLAST
Transmembranei1708 – 173124Helical; Name=S4 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1732 – 174514Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei1746 – 176621Helical; Name=S5 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1767 – 182660Extracellular Reviewed prediction
Add
BLAST
Transmembranei1827 – 185428Helical; Name=S6 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1855 – 2377523Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. plasma membrane Source: RefGenome
  2. voltage-gated calcium channel complex Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA381.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 23772377Voltage-dependent T-type calcium channel subunit alpha-1G
PRO_0000053952Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi173 – 1731N-linked (GlcNAc...) Reviewed prediction
Glycosylationi246 – 2461N-linked (GlcNAc...) Reviewed prediction
Glycosylationi306 – 3061N-linked (GlcNAc...) Reviewed prediction
Glycosylationi310 – 3101N-linked (GlcNAc...) Reviewed prediction
Glycosylationi322 – 3221N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1448 – 14481N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1451 – 14511N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1698 – 16981N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

In response to raising of intracellular calcium, the T-type channels are activated by CaM-kinase II.

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiO43497.
PRIDEiO43497.

PTM databases

PhosphoSiteiO43497.

Expressioni

Tissue specificityi

Highly expressed in brain, in particular in the amygdala, subthalamic nuclei, cerebellum and thalamus. Moderate expression in heart; low expression in placenta, kidney and lung. Also expressed in colon and bone marrow and in tumoral cells to a lesser extent. Highly expressed in fetal brain, but also in peripheral fetal tissues as heart, kidney and lung, suggesting a developmentally regulated expression.

Developmental stagei

Isoform 4, isoform 7, isoform 18, isoform 19, isoform 24, isoform 25 and isoform 31 are adult-specific. Isoform 8, isoform 14, isoform 15, isoform 16, isoform 17, isoform 20, isoform 21, isoform 22, isoform 23, isoform 26, isoform 27, isoform 28, isoform 29 and isoform 30 are fetal-specific. Isoform 1, isoform 2, isoform 6, isoform 9, isoform 11, isoform 12 and isoform 13 are expressed in both fetus and adult.1 Publication

Gene expression databases

ArrayExpressiO43497.
BgeeiO43497.
GenevestigatoriO43497.

Organism-specific databases

HPAiHPA004714.

Interactioni

Protein-protein interaction databases

BioGridi114427. 1 interaction.
IntActiO43497. 2 interactions.
MINTiMINT-2796172.

Structurei

3D structure databases

ProteinModelPortaliO43497.
SMRiO43497. Positions 82-234, 745-976, 1278-1549, 1617-1863.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati68 – 398331I
Add
BLAST
Repeati729 – 967239II
Add
BLAST
Repeati1263 – 1540278III
Add
BLAST
Repeati1596 – 1854259IV
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi290 – 2956Poly-Gly
Compositional biasi496 – 50611Poly-His
Add
BLAST

Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.
The linker region between repeat III and IV probably plays a role in the inactivation of the channel. The C-terminal part may be implicated in the anchoring of the protein to the membrane by interfering with or restricting its lateral diffusion.

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1226.
HOVERGENiHBG050764.
InParanoidiO43497.
KOiK04854.
OMAiQRCRILQ.
OrthoDBiEOG7MKW55.
PhylomeDBiO43497.
TreeFamiTF313555.

Family and domain databases

Gene3Di1.20.120.350. 4 hits.
InterProiIPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR005445. VDCC_T_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamiPF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01629. TVDCCALPHA1.

Sequences (35)i

Sequence statusi: Complete.

This entry describes 35 isoformsi produced by alternative splicing. Align

Isoform 5 (identifier: O43497-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDEEEDGAGA EESGQPRSFM RLNDLSGAGG RPGPGSAEKD PGSADSEAEG     50
LPYPALAPVV FFYLSQDSRP RSWCLRTVCN PWFERISMLV ILLNCVTLGM 100
FRPCEDIACD SQRCRILQAF DDFIFAFFAV EMVVKMVALG IFGKKCYLGD 150
TWNRLDFFIV IAGMLEYSLD LQNVSFSAVR TVRVLRPLRA INRVPSMRIL 200
VTLLLDTLPM LGNVLLLCFF VFFIFGIVGV QLWAGLLRNR CFLPENFSLP 250
LSVDLERYYQ TENEDESPFI CSQPRENGMR SCRSVPTLRG DGGGGPPCGL 300
DYEAYNSSSN TTCVNWNQYY TNCSAGEHNP FKGAINFDNI GYAWIAIFQV 350
ITLEGWVDIM YFVMDAHSFY NFIYFILLII VGSFFMINLC LVVIATQFSE 400
TKQRESQLMR EQRVRFLSNA STLASFSEPG SCYEELLKYL VYILRKAARR 450
LAQVSRAAGV RVGLLSSPAP LGGQETQPSS SCSRSHRRLS VHHLVHHHHH 500
HHHHYHLGNG TLRAPRASPE IQDRDANGSR RLMLPPPSTP ALSGAPPGGA 550
ESVHSFYHAD CHLEPVRCQA PPPRSPSEAS GRTVGSGKVY PTVHTSPPPE 600
TLKEKALVEV AASSGPPTLT SLNIPPGPYS SMHKLLETQS TGACQSSCKI 650
SSPCLKADSG ACGPDSCPYC ARAGAGEVEL ADREMPDSDS EAVYEFTQDA 700
QHSDLRDPHS RRQRSLGPDA EPSSVLAFWR LICDTFRKIV DSKYFGRGIM 750
IAILVNTLSM GIEYHEQPEE LTNALEISNI VFTSLFALEM LLKLLVYGPF 800
GYIKNPYNIF DGVIVVISVW EIVGQQGGGL SVLRTFRLMR VLKLVRFLPA 850
LQRQLVVLMK TMDNVATFCM LLMLFIFIFS ILGMHLFGCK FASERDGDTL 900
PDRKNFDSLL WAIVTVFQIL TQEDWNKVLY NGMASTSSWA ALYFIALMTF 950
GNYVLFNLLV AILVEGFQAE EISKREDASG QLSCIQLPVD SQGGDANKSE 1000
SEPDFFSPSL DGDGDRKKCL ALVSLGEHPE LRKSLLPPLI IHTAATPMSL 1050
PKSTSTGLGE ALGPASRRTS SSGSAEPGAA HEMKSPPSAR SSPHSPWSAA 1100
SSWTSRRSSR NSLGRAPSLK RRSPSGERRS LLSGEGQESQ DEEESSEEER 1150
ASPAGSDHRH RGSLEREAKS SFDLPDTLQV PGLHRTASGR GSASEHQDCN 1200
GKSASGRLAR ALRPDDPPLD GDDADDEGNL SKGERVRAWI RARLPACCLE 1250
RDSWSAYIFP PQSRFRLLCH RIITHKMFDH VVLVIIFLNC ITIAMERPKI 1300
DPHSAERIFL TLSNYIFTAV FLAEMTVKVV ALGWCFGEQA YLRSSWNVLD 1350
GLLVLISVID ILVSMVSDSG TKILGMLRVL RLLRTLRPLR VISRAQGLKL 1400
VVETLMSSLK PIGNIVVICC AFFIIFGILG VQLFKGKFFV CQGEDTRNIT 1450
NKSDCAEASY RWVRHKYNFD NLGQALMSLF VLASKDGWVD IMYDGLDAVG 1500
VDQQPIMNHN PWMLLYFISF LLIVAFFVLN MFVGVVVENF HKCRQHQEEE 1550
EARRREEKRL RRLEKKRRNL MLDDVIASGS SASAASEAQC KPYYSDYSRF 1600
RLLVHHLCTS HYLDLFITGV IGLNVVTMAM EHYQQPQILD EALKICNYIF 1650
TVIFVLESVF KLVAFGFRRF FQDRWNQLDL AIVLLSIMGI TLEEIEVNAS 1700
LPINPTIIRI MRVLRIARVL KLLKMAVGMR ALLDTVMQAL PQVGNLGLLF 1750
MLLFFIFAAL GVELFGDLEC DETHPCEGLG RHATFRNFGM AFLTLFRVST 1800
GDNWNGIMKD TLRDCDQEST CYNTVISPIY FVSFVLTAQF VLVNVVIAVL 1850
MKHLEESNKE AKEEAELEAE LELEMKTLSP QPHSPLGSPF LWPGVEGPDS 1900
PDSPKPGALH PAAHARSASH FSLEHPTDRQ LFDTISLLIQ GSLEWELKLM 1950
DELAGPGGQP SAFPSAPSLG GSDPQIPLAE MEALSLTSEI VSEPSCSLAL 2000
TDDSLPDDMH TLLLSALESN MQPHPTELPG PDLLTVRKSG VSRTHSLPND 2050
SYMCRHGSTA EGPLGHRGWG LPKAQSGSVL SVHSQPADTS YILQLPKDAP 2100
HLLQPHSAPT WGTIPKLPPP GRSPLAQRPL RRQAAIRTDS LDVQGLGSRE 2150
DLLAEVSGPS PPLARAYSFW GQSSTQAQQH SRSHSKISKH MTPPAPCPGP 2200
EPNWGKGPPE TRSSLELDTE LSWISGDLLP PGGQEEPPSP RDLKKCYSVE 2250
AQSCQRRPTS WLDEQRRHSI AVSCLDSGSQ PHLGTDPSNL GGQPLGGPGS 2300
RPKKKLSPPS ITIDPPESQG PRTPPSPGIC LRRRAPSSDS KDPLASGPPD 2350
SMAASPSPKK DVLSLSGLSS DPADLDP 2377
Length:2,377
Mass (Da):262,472
Last modified:December 1, 2000 - v3
Checksum:i1C9F7C557D9D32DF
GO
Isoform 1 (identifier: O43497-2) [UniParc]FASTAAdd to Basket

Also known as: Variant 89

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Show »
Length:2,250
Mass (Da):249,333
Checksum:iACDCB167AA5DF18F
GO
Isoform 2 (identifier: O43497-3) [UniParc]FASTAAdd to Basket

Also known as: Variant 25

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1587: NLMLDDVIASGSSASAASE → K
     1928-2020: Missing.

Show »
Length:2,243
Mass (Da):248,529
Checksum:i74FA50071A5F9FBD
GO
Isoform 3 (identifier: O43497-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.

Show »
Length:2,354
Mass (Da):260,029
Checksum:i2F13189AF179C9E2
GO
Isoform 4 (identifier: O43497-5) [UniParc]FASTAAdd to Basket

Also known as: Variant 88

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.
     2156-2234: Missing.

Show »
Length:2,171
Mass (Da):240,920
Checksum:i1C5BEDD83C1C8FB7
GO
Isoform 6 (identifier: O43497-6) [UniParc]FASTAAdd to Basket

Also known as: Variant 217

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Show »
Length:2,273
Mass (Da):251,776
Checksum:iBBE93AF4CCAC8F8D
GO
Isoform 7 (identifier: O43497-7) [UniParc]FASTAAdd to Basket

Also known as: Variant 221

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1976-2020: Missing.

Show »
Length:2,321
Mass (Da):256,828
Checksum:i2051A97223D0081D
GO
Isoform 8 (identifier: O43497-8) [UniParc]FASTAAdd to Basket

Also known as: Variant 93

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1976-2020: Missing.

Show »
Length:2,298
Mass (Da):254,386
Checksum:iEF51D26EC38F66F8
GO
Isoform 9 (identifier: O43497-9) [UniParc]FASTAAdd to Basket

Also known as: Variant 57

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1928-2020: Missing.

Show »
Length:2,261
Mass (Da):250,221
Checksum:iDCA090B5433D83E1
GO
Isoform 10 (identifier: O43497-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1928-1975: Missing.

Show »
Length:2,306
Mass (Da):254,976
Checksum:i943D153CFCC75CF8
GO
Isoform 11 (identifier: O43497-11) [UniParc]FASTAAdd to Basket

Also known as: Variant 185

The sequence of this isoform differs from the canonical sequence as follows:
     1928-2020: Missing.

Show »
Length:2,284
Mass (Da):252,664
Checksum:iFCB59420799A126E
GO
Isoform 12 (identifier: O43497-12) [UniParc]FASTAAdd to Basket

Also known as: Variant 189

The sequence of this isoform differs from the canonical sequence as follows:
     1976-2020: Missing.

Show »
Length:2,332
Mass (Da):257,716
Checksum:i74F41CEA601E8CBC
GO
Isoform 13 (identifier: O43497-13) [UniParc]FASTAAdd to Basket

Also known as: Variant 153

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1928-2020: Missing.

Show »
Length:2,266
Mass (Da):250,972
Checksum:i66E3563375ED61DA
GO
Isoform 14 (identifier: O43497-15) [UniParc]FASTAAdd to Basket

Also known as: Variant 137

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1737-1743: Missing.
     1928-2020: Missing.

Show »
Length:2,259
Mass (Da):250,204
Checksum:i4DB0EDC2873FB788
GO
Isoform 15 (identifier: O43497-16) [UniParc]FASTAAdd to Basket

Also known as: Variant 157

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1976-2020: Missing.

Show »
Length:2,314
Mass (Da):256,024
Checksum:i8C9D69B5A3C86C21
GO
Isoform 16 (identifier: O43497-17) [UniParc]FASTAAdd to Basket

Also known as: Variant 169

The sequence of this isoform differs from the canonical sequence as follows:
     1737-1743: Missing.
     1928-2020: Missing.

Show »
Length:2,277
Mass (Da):251,896
Checksum:iB942CD535E125104
GO
Isoform 17 (identifier: O43497-18) [UniParc]FASTAAdd to Basket

Also known as: Variant 184

The sequence of this isoform differs from the canonical sequence as follows:
     1928-2020: Missing.
     2156-2234: Missing.

Show »
Length:2,205
Mass (Da):244,250
Checksum:iE059BCB89C6929DA
GO
Isoform 18 (identifier: O43497-19) [UniParc]FASTAAdd to Basket

Also known as: Variant 216

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.
     2156-2234: Missing.

Show »
Length:2,194
Mass (Da):243,362
Checksum:i1A2CC9E24EDDECA1
GO
Isoform 19 (identifier: O43497-20) [UniParc]FASTAAdd to Basket

Also known as: Variant 223

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA

Show »
Length:2,366
Mass (Da):261,584
Checksum:i2CBDED941FB8B793
GO
Isoform 20 (identifier: O43497-21) [UniParc]FASTAAdd to Basket

Also known as: Variant 249

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1569: N → SKEKQMAD
     1928-2020: Missing.

Show »
Length:2,291
Mass (Da):253,467
Checksum:i031D1E0372857147
GO
Isoform 21 (identifier: O43497-22) [UniParc]FASTAAdd to Basket

Also known as: Variant 313

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1505-1538: Missing.
     1928-2020: Missing.

Show »
Length:2,227
Mass (Da):246,224
Checksum:iE0F263D2479502B0
GO
Isoform 22 (identifier: O43497-23) [UniParc]FASTAAdd to Basket

Also known as: Variant 409

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1569-1587: NLMLDDVIASGSSASAASE → K
     1928-2020: Missing.

Show »
Length:2,232
Mass (Da):246,975
Checksum:iCC32AACAC448BE1A
GO
Isoform 23 (identifier: O43497-24) [UniParc]FASTAAdd to Basket

Also known as: Variant 441

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1928-2020: Missing.

Show »
Length:2,250
Mass (Da):248,667
Checksum:i3196A2446C52D0D5
GO
Isoform 24 (identifier: O43497-25) [UniParc]FASTAAdd to Basket

Also known as: Variant 477

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1976-2020: Missing.

Show »
Length:2,287
Mass (Da):252,831
Checksum:i38379DC69AAACA57
GO
Isoform 25 (identifier: O43497-26) [UniParc]FASTAAdd to Basket

Also known as: Variant 473

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1538: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Show »
Length:2,239
Mass (Da):247,779
Checksum:i15CBEF30957AAB27
GO
Isoform 26 (identifier: O43497-27) [UniParc]FASTAAdd to Basket

Also known as: Variant 17

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1587: NLMLDDVIASGSSASAASE → K
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.

Show »
Length:1,735
Mass (Da):194,084
Checksum:iF8C3FE1FDB00B3A8
GO
Isoform 27 (identifier: O43497-28) [UniParc]FASTAAdd to Basket

Also known as: Variant 33

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1736-1769: VMQALPQVGNLGLLFMLLFFIFAALGVELFGDLE → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1770-2377: Missing.

Show »
Length:1,746
Mass (Da):195,008
Checksum:iF7562C646DF6275D
GO
Isoform 28 (identifier: O43497-29) [UniParc]FASTAAdd to Basket

Also known as: Variant 49

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.

Show »
Length:1,753
Mass (Da):195,776
Checksum:i0A6D75AA5418BCCA
GO
Isoform 29 (identifier: O43497-30) [UniParc]FASTAAdd to Basket

Also known as: Variant 145

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1587: NLMLDDVIASGSSASAASE → K
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.

Show »
Length:1,758
Mass (Da):196,527
Checksum:i79746C4F53C48A96
GO
Isoform 30 (identifier: O43497-31) [UniParc]FASTAAdd to Basket

Also known as: Variant 177

The sequence of this isoform differs from the canonical sequence as follows:
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.

Show »
Length:1,776
Mass (Da):198,218
Checksum:i8A58FF574B070494
GO
Isoform 31 (identifier: O43497-32) [UniParc]FASTAAdd to Basket

Also known as: Variant 209

The sequence of this isoform differs from the canonical sequence as follows:
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1743-1776: VGNLGLLFMLLFFIFAALGVELFGDLECDETHPC → LWAWSSLETWSVTRHTPVRAWAVMPPFGTLAWPS
     1777-2377: Missing.

Show »
Length:1,765
Mass (Da):197,330
Checksum:iC26247C1EAE03CFE
GO
Isoform 32 (identifier: O43497-33) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     971-993: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA

Note: Gene prediction based on EST data.

Show »
Length:2,343
Mass (Da):259,141
Checksum:i01E1315F5E43FF9C
GO
Isoform 33 (identifier: O43497-34) [UniParc]FASTAAdd to Basket

Also known as: Variant 441-d81

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1531: Missing.
     1928-2020: Missing.

Show »
Length:2,257
Mass (Da):249,396
Checksum:i7271F3B05E9438BA
GO
Isoform 34 (identifier: O43497-35) [UniParc]FASTAAdd to Basket

Also known as: Variant 473-d75

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1529: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Show »
Length:2,248
Mass (Da):248,754
Checksum:i302BC6EC72A65A1F
GO
Isoform 35 (identifier: O43497-36) [UniParc]FASTAAdd to Basket

Also known as: Variant 473-d81

The sequence of this isoform differs from the canonical sequence as follows:
     1505-1531: Missing.
     1569-1586: NLMLDDVIASGSSASAAS → SKEKQMA
     1928-2020: Missing.

Show »
Length:2,246
Mass (Da):248,509
Checksum:iF99DA2229E40387E
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei971 – 99323Missing in isoform 1, isoform 2, isoform 3, isoform 4, isoform 8, isoform 9, isoform 10, isoform 21, isoform 26, isoform 27, isoform 28 and isoform 32.
VSP_000940Add
BLAST
Alternative sequencei1505 – 153834Missing in isoform 21, isoform 22, isoform 23, isoform 24 and isoform 25.
VSP_047545Add
BLAST
Alternative sequencei1505 – 153127Missing in isoform 33 and isoform 35.
VSP_047546Add
BLAST
Alternative sequencei1505 – 152925Missing in isoform 34.
VSP_047547Add
BLAST
Alternative sequencei1569 – 158719NLMLD…SAASE → K in isoform 2, isoform 13, isoform 14, isoform 15, isoform 22, isoform 26 and isoform 29.
VSP_000944Add
BLAST
Alternative sequencei1569 – 158618NLMLD…ASAAS → SKEKQMA in isoform 1, isoform 4, isoform 6, isoform 7, isoform 8, isoform 18, isoform 19, isoform 24, isoform 25, isoform 31, isoform 32, isoform 34 and isoform 35.
VSP_000943Add
BLAST
Alternative sequencei1569 – 15691N → SKEKQMAD in isoform 20.
VSP_047548
Alternative sequencei1736 – 176934VMQAL…FGDLE → LWAWSSLETWSVTRHTPVRA WAVMPPFGTLAWPS in isoform 27.
VSP_047549Add
BLAST
Alternative sequencei1737 – 17437Missing in isoform 14 and isoform 16.
VSP_047550
Alternative sequencei1743 – 177634VGNLG…ETHPC → LWAWSSLETWSVTRHTPVRA WAVMPPFGTLAWPS in isoform 26, isoform 28, isoform 29, isoform 30 and isoform 31.
VSP_047551Add
BLAST
Alternative sequencei1770 – 2377608Missing in isoform 27.
VSP_047552Add
BLAST
Alternative sequencei1777 – 2377601Missing in isoform 26, isoform 28, isoform 29, isoform 30 and isoform 31.
VSP_047553Add
BLAST
Alternative sequencei1928 – 202093Missing in isoform 1, isoform 2, isoform 4, isoform 6, isoform 9, isoform 11, isoform 13, isoform 14, isoform 16, isoform 17, isoform 18, isoform 20, isoform 21, isoform 22, isoform 23, isoform 25, isoform 33, isoform 34 and isoform 35.
VSP_000946Add
BLAST
Alternative sequencei1928 – 197548Missing in isoform 10.
VSP_000945Add
BLAST
Alternative sequencei1976 – 202045Missing in isoform 7, isoform 8, isoform 12, isoform 15 and isoform 24.
VSP_000947Add
BLAST
Alternative sequencei2156 – 223479Missing in isoform 4, isoform 17 and isoform 18.
VSP_000948Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1345 – 13451S → I in AAD12731. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF124351 mRNA. Translation: AAD34352.1.
AF134985 mRNA. Translation: AAF19346.1.
AF134986 mRNA. Translation: AAF19347.1.
AF190860 mRNA. Translation: AAF35287.1.
AF126965 mRNA. Translation: AAD29400.1.
AF126966 mRNA. Translation: AAD29401.1.
AF227744 mRNA. Translation: AAF37689.1.
AF227745 mRNA. Translation: AAF37690.1.
AF227746 mRNA. Translation: AAF37691.1.
AF227747 mRNA. Translation: AAF37692.1.
AF227748 mRNA. Translation: AAF37693.1.
AF227749 mRNA. Translation: AAF37694.1.
AF227750 mRNA. Translation: AAF37695.1.
AF227751 mRNA. Translation: AAF37696.1.
DQ494449 mRNA. Translation: ABF69900.1.
DQ494450 mRNA. Translation: ABF69901.1.
DQ494451 mRNA. Translation: ABF69902.1.
DQ494452 mRNA. Translation: ABF69903.1.
DQ494453 mRNA. Translation: ABF69904.1.
DQ494454 mRNA. Translation: ABF69905.1.
DQ494455 mRNA. Translation: ABF69906.1.
DQ494456 mRNA. Translation: ABF69907.1.
DQ494457 mRNA. Translation: ABF69908.1.
DQ494458 mRNA. Translation: ABF69909.1.
DQ494459 mRNA. Translation: ABF69910.1.
DQ494460 mRNA. Translation: ABF69911.1.
DQ494461 mRNA. Translation: ABF69912.1.
DQ494462 mRNA. Translation: ABF69913.1.
DQ494463 mRNA. Translation: ABF69914.1.
DQ494464 mRNA. Translation: ABF69915.1.
DQ494465 mRNA. Translation: ABF69916.1.
DQ494466 mRNA. Translation: ABF69917.1.
DQ494467 mRNA. Translation: ABF69918.1.
DQ494468 mRNA. Translation: ABF69919.1.
DQ494469 mRNA. Translation: ABF69920.1.
DQ494470 mRNA. Translation: ABF69921.1.
DQ494471 mRNA. Translation: ABF69922.1.
DQ494472 mRNA. Translation: ABF69923.1.
DQ494473 mRNA. Translation: ABF69924.1.
DQ494474 mRNA. Translation: ABF69925.1.
DQ494475 mRNA. Translation: ABF69926.1.
DQ494476 mRNA. Translation: ABF69927.1.
DQ494477 mRNA. Translation: ABF69928.1.
DQ494478 mRNA. Translation: ABF69929.1.
DQ494479 mRNA. Translation: ABF69930.1.
AC004590 Genomic DNA. No translation available.
AC021491 Genomic DNA. No translation available.
BC110995 mRNA. Translation: AAI10996.1.
AB032949 mRNA. Translation: BAA86437.2.
AF029228 mRNA. Translation: AAD12731.1.
AF029229 mRNA. Translation: AAD12732.1.
CCDSiCCDS45730.1. [O43497-1]
CCDS45731.1. [O43497-12]
CCDS45732.1. [O43497-11]
CCDS45733.1. [O43497-13]
CCDS45734.1. [O43497-33]
CCDS45735.1. [O43497-2]
CCDS45736.1. [O43497-5]
CCDS45737.1. [O43497-10]
CCDS54142.1. [O43497-7]
CCDS54143.1. [O43497-6]
CCDS54144.1. [O43497-9]
CCDS54145.1. [O43497-3]
CCDS54146.1. [O43497-8]
CCDS58565.1. [O43497-17]
CCDS58566.1. [O43497-18]
CCDS58567.1. [O43497-15]
CCDS58568.1. [O43497-16]
CCDS58569.1. [O43497-21]
CCDS58570.1. [O43497-20]
CCDS58571.1. [O43497-19]
CCDS58572.1. [O43497-24]
CCDS58573.1. [O43497-23]
CCDS58574.1. [O43497-25]
CCDS58575.1. [O43497-26]
CCDS58576.1. [O43497-22]
RefSeqiNP_001243253.1. NM_001256324.1. [O43497-16]
NP_001243254.1. NM_001256325.1. [O43497-21]
NP_001243255.1. NM_001256326.1. [O43497-25]
NP_001243256.1. NM_001256327.1. [O43497-17]
NP_001243257.1. NM_001256328.1. [O43497-15]
NP_001243258.1. NM_001256329.1. [O43497-24]
NP_001243259.1. NM_001256330.1. [O43497-26]
NP_001243260.1. NM_001256331.1. [O43497-23]
NP_001243261.1. NM_001256332.1. [O43497-22]
NP_001243262.1. NM_001256333.1. [O43497-18]
NP_001243263.1. NM_001256334.1. [O43497-19]
NP_001243288.1. NM_001256359.1. [O43497-34]
NP_001243289.1. NM_001256360.1. [O43497-35]
NP_001243290.1. NM_001256361.1. [O43497-36]
NP_061496.2. NM_018896.4. [O43497-1]
NP_938190.1. NM_198376.2. [O43497-5]
NP_938191.2. NM_198377.2. [O43497-20]
NP_938192.1. NM_198378.2. [O43497-6]
NP_938193.1. NM_198379.2. [O43497-8]
NP_938194.1. NM_198380.2. [O43497-7]
NP_938196.1. NM_198382.2. [O43497-9]
NP_938197.1. NM_198383.2. [O43497-10]
NP_938198.1. NM_198384.2. [O43497-11]
NP_938199.1. NM_198385.2. [O43497-12]
NP_938200.1. NM_198386.2. [O43497-13]
NP_938201.1. NM_198387.2. [O43497-2]
NP_938202.1. NM_198388.2. [O43497-3]
NP_938406.1. NM_198396.2. [O43497-33]
UniGeneiHs.591169.

Genome annotation databases

EnsembliENST00000352832; ENSP00000339302; ENSG00000006283. [O43497-2]
ENST00000354983; ENSP00000347078; ENSG00000006283. [O43497-33]
ENST00000358244; ENSP00000350979; ENSG00000006283. [O43497-5]
ENST00000359106; ENSP00000352011; ENSG00000006283. [O43497-1]
ENST00000360761; ENSP00000353990; ENSG00000006283. [O43497-9]
ENST00000429973; ENSP00000414388; ENSG00000006283. [O43497-13]
ENST00000442258; ENSP00000409759; ENSG00000006283. [O43497-3]
ENST00000502264; ENSP00000425522; ENSG00000006283. [O43497-10]
ENST00000503436; ENSP00000427231; ENSG00000006283. [O43497-29]
ENST00000503485; ENSP00000427238; ENSG00000006283. [O43497-24]
ENST00000503607; ENSP00000426558; ENSG00000006283. [O43497-27]
ENST00000504076; ENSP00000425153; ENSG00000006283. [O43497-32]
ENST00000505165; ENSP00000422268; ENSG00000006283. [O43497-18]
ENST00000506406; ENSP00000426313; ENSG00000006283. [O43497-31]
ENST00000507336; ENSP00000420918; ENSG00000006283. [O43497-20]
ENST00000507510; ENSP00000423112; ENSG00000006283. [O43497-12]
ENST00000507609; ENSP00000423045; ENSG00000006283. [O43497-17]
ENST00000507896; ENSP00000421518; ENSG00000006283. [O43497-19]
ENST00000510115; ENSP00000427173; ENSG00000006283. [O43497-8]
ENST00000510366; ENSP00000426814; ENSG00000006283. [O43497-23]
ENST00000511765; ENSP00000427247; ENSG00000006283. [O43497-30]
ENST00000511768; ENSP00000424664; ENSG00000006283. [O43497-28]
ENST00000512389; ENSP00000426261; ENSG00000006283. [O43497-6]
ENST00000513689; ENSP00000426172; ENSG00000006283. [O43497-25]
ENST00000513964; ENSP00000425451; ENSG00000006283. [O43497-26]
ENST00000514079; ENSP00000423317; ENSG00000006283. [O43497-21]
ENST00000514181; ENSP00000425698; ENSG00000006283. [O43497-15]
ENST00000514717; ENSP00000422407; ENSG00000006283. [O43497-22]
ENST00000515165; ENSP00000426098; ENSG00000006283. [O43497-11]
ENST00000515411; ENSP00000423155; ENSG00000006283. [O43497-16]
ENST00000515765; ENSP00000426232; ENSG00000006283. [O43497-7]
GeneIDi8913.
KEGGihsa:8913.
UCSCiuc002irk.2. human. [O43497-1]
uc002irl.2. human.
uc002irw.2. human. [O43497-10]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF124351 mRNA. Translation: AAD34352.1 .
AF134985 mRNA. Translation: AAF19346.1 .
AF134986 mRNA. Translation: AAF19347.1 .
AF190860 mRNA. Translation: AAF35287.1 .
AF126965 mRNA. Translation: AAD29400.1 .
AF126966 mRNA. Translation: AAD29401.1 .
AF227744 mRNA. Translation: AAF37689.1 .
AF227745 mRNA. Translation: AAF37690.1 .
AF227746 mRNA. Translation: AAF37691.1 .
AF227747 mRNA. Translation: AAF37692.1 .
AF227748 mRNA. Translation: AAF37693.1 .
AF227749 mRNA. Translation: AAF37694.1 .
AF227750 mRNA. Translation: AAF37695.1 .
AF227751 mRNA. Translation: AAF37696.1 .
DQ494449 mRNA. Translation: ABF69900.1 .
DQ494450 mRNA. Translation: ABF69901.1 .
DQ494451 mRNA. Translation: ABF69902.1 .
DQ494452 mRNA. Translation: ABF69903.1 .
DQ494453 mRNA. Translation: ABF69904.1 .
DQ494454 mRNA. Translation: ABF69905.1 .
DQ494455 mRNA. Translation: ABF69906.1 .
DQ494456 mRNA. Translation: ABF69907.1 .
DQ494457 mRNA. Translation: ABF69908.1 .
DQ494458 mRNA. Translation: ABF69909.1 .
DQ494459 mRNA. Translation: ABF69910.1 .
DQ494460 mRNA. Translation: ABF69911.1 .
DQ494461 mRNA. Translation: ABF69912.1 .
DQ494462 mRNA. Translation: ABF69913.1 .
DQ494463 mRNA. Translation: ABF69914.1 .
DQ494464 mRNA. Translation: ABF69915.1 .
DQ494465 mRNA. Translation: ABF69916.1 .
DQ494466 mRNA. Translation: ABF69917.1 .
DQ494467 mRNA. Translation: ABF69918.1 .
DQ494468 mRNA. Translation: ABF69919.1 .
DQ494469 mRNA. Translation: ABF69920.1 .
DQ494470 mRNA. Translation: ABF69921.1 .
DQ494471 mRNA. Translation: ABF69922.1 .
DQ494472 mRNA. Translation: ABF69923.1 .
DQ494473 mRNA. Translation: ABF69924.1 .
DQ494474 mRNA. Translation: ABF69925.1 .
DQ494475 mRNA. Translation: ABF69926.1 .
DQ494476 mRNA. Translation: ABF69927.1 .
DQ494477 mRNA. Translation: ABF69928.1 .
DQ494478 mRNA. Translation: ABF69929.1 .
DQ494479 mRNA. Translation: ABF69930.1 .
AC004590 Genomic DNA. No translation available.
AC021491 Genomic DNA. No translation available.
BC110995 mRNA. Translation: AAI10996.1 .
AB032949 mRNA. Translation: BAA86437.2 .
AF029228 mRNA. Translation: AAD12731.1 .
AF029229 mRNA. Translation: AAD12732.1 .
CCDSi CCDS45730.1. [O43497-1 ]
CCDS45731.1. [O43497-12 ]
CCDS45732.1. [O43497-11 ]
CCDS45733.1. [O43497-13 ]
CCDS45734.1. [O43497-33 ]
CCDS45735.1. [O43497-2 ]
CCDS45736.1. [O43497-5 ]
CCDS45737.1. [O43497-10 ]
CCDS54142.1. [O43497-7 ]
CCDS54143.1. [O43497-6 ]
CCDS54144.1. [O43497-9 ]
CCDS54145.1. [O43497-3 ]
CCDS54146.1. [O43497-8 ]
CCDS58565.1. [O43497-17 ]
CCDS58566.1. [O43497-18 ]
CCDS58567.1. [O43497-15 ]
CCDS58568.1. [O43497-16 ]
CCDS58569.1. [O43497-21 ]
CCDS58570.1. [O43497-20 ]
CCDS58571.1. [O43497-19 ]
CCDS58572.1. [O43497-24 ]
CCDS58573.1. [O43497-23 ]
CCDS58574.1. [O43497-25 ]
CCDS58575.1. [O43497-26 ]
CCDS58576.1. [O43497-22 ]
RefSeqi NP_001243253.1. NM_001256324.1. [O43497-16 ]
NP_001243254.1. NM_001256325.1. [O43497-21 ]
NP_001243255.1. NM_001256326.1. [O43497-25 ]
NP_001243256.1. NM_001256327.1. [O43497-17 ]
NP_001243257.1. NM_001256328.1. [O43497-15 ]
NP_001243258.1. NM_001256329.1. [O43497-24 ]
NP_001243259.1. NM_001256330.1. [O43497-26 ]
NP_001243260.1. NM_001256331.1. [O43497-23 ]
NP_001243261.1. NM_001256332.1. [O43497-22 ]
NP_001243262.1. NM_001256333.1. [O43497-18 ]
NP_001243263.1. NM_001256334.1. [O43497-19 ]
NP_001243288.1. NM_001256359.1. [O43497-34 ]
NP_001243289.1. NM_001256360.1. [O43497-35 ]
NP_001243290.1. NM_001256361.1. [O43497-36 ]
NP_061496.2. NM_018896.4. [O43497-1 ]
NP_938190.1. NM_198376.2. [O43497-5 ]
NP_938191.2. NM_198377.2. [O43497-20 ]
NP_938192.1. NM_198378.2. [O43497-6 ]
NP_938193.1. NM_198379.2. [O43497-8 ]
NP_938194.1. NM_198380.2. [O43497-7 ]
NP_938196.1. NM_198382.2. [O43497-9 ]
NP_938197.1. NM_198383.2. [O43497-10 ]
NP_938198.1. NM_198384.2. [O43497-11 ]
NP_938199.1. NM_198385.2. [O43497-12 ]
NP_938200.1. NM_198386.2. [O43497-13 ]
NP_938201.1. NM_198387.2. [O43497-2 ]
NP_938202.1. NM_198388.2. [O43497-3 ]
NP_938406.1. NM_198396.2. [O43497-33 ]
UniGenei Hs.591169.

3D structure databases

ProteinModelPortali O43497.
SMRi O43497. Positions 82-234, 745-976, 1278-1549, 1617-1863.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114427. 1 interaction.
IntActi O43497. 2 interactions.
MINTi MINT-2796172.

Chemistry

BindingDBi O43497.
ChEMBLi CHEMBL2362995.
DrugBanki DB00593. Ethosuximide.
DB04841. Flunarizine.
DB01202. Levetiracetam.
DB01388. Mibefradil.
DB01100. Pimozide.
DB00347. Trimethadione.
DB00661. Verapamil.
DB00909. Zonisamide.
GuidetoPHARMACOLOGYi 535.

PTM databases

PhosphoSitei O43497.

Proteomic databases

PaxDbi O43497.
PRIDEi O43497.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000352832 ; ENSP00000339302 ; ENSG00000006283 . [O43497-2 ]
ENST00000354983 ; ENSP00000347078 ; ENSG00000006283 . [O43497-33 ]
ENST00000358244 ; ENSP00000350979 ; ENSG00000006283 . [O43497-5 ]
ENST00000359106 ; ENSP00000352011 ; ENSG00000006283 . [O43497-1 ]
ENST00000360761 ; ENSP00000353990 ; ENSG00000006283 . [O43497-9 ]
ENST00000429973 ; ENSP00000414388 ; ENSG00000006283 . [O43497-13 ]
ENST00000442258 ; ENSP00000409759 ; ENSG00000006283 . [O43497-3 ]
ENST00000502264 ; ENSP00000425522 ; ENSG00000006283 . [O43497-10 ]
ENST00000503436 ; ENSP00000427231 ; ENSG00000006283 . [O43497-29 ]
ENST00000503485 ; ENSP00000427238 ; ENSG00000006283 . [O43497-24 ]
ENST00000503607 ; ENSP00000426558 ; ENSG00000006283 . [O43497-27 ]
ENST00000504076 ; ENSP00000425153 ; ENSG00000006283 . [O43497-32 ]
ENST00000505165 ; ENSP00000422268 ; ENSG00000006283 . [O43497-18 ]
ENST00000506406 ; ENSP00000426313 ; ENSG00000006283 . [O43497-31 ]
ENST00000507336 ; ENSP00000420918 ; ENSG00000006283 . [O43497-20 ]
ENST00000507510 ; ENSP00000423112 ; ENSG00000006283 . [O43497-12 ]
ENST00000507609 ; ENSP00000423045 ; ENSG00000006283 . [O43497-17 ]
ENST00000507896 ; ENSP00000421518 ; ENSG00000006283 . [O43497-19 ]
ENST00000510115 ; ENSP00000427173 ; ENSG00000006283 . [O43497-8 ]
ENST00000510366 ; ENSP00000426814 ; ENSG00000006283 . [O43497-23 ]
ENST00000511765 ; ENSP00000427247 ; ENSG00000006283 . [O43497-30 ]
ENST00000511768 ; ENSP00000424664 ; ENSG00000006283 . [O43497-28 ]
ENST00000512389 ; ENSP00000426261 ; ENSG00000006283 . [O43497-6 ]
ENST00000513689 ; ENSP00000426172 ; ENSG00000006283 . [O43497-25 ]
ENST00000513964 ; ENSP00000425451 ; ENSG00000006283 . [O43497-26 ]
ENST00000514079 ; ENSP00000423317 ; ENSG00000006283 . [O43497-21 ]
ENST00000514181 ; ENSP00000425698 ; ENSG00000006283 . [O43497-15 ]
ENST00000514717 ; ENSP00000422407 ; ENSG00000006283 . [O43497-22 ]
ENST00000515165 ; ENSP00000426098 ; ENSG00000006283 . [O43497-11 ]
ENST00000515411 ; ENSP00000423155 ; ENSG00000006283 . [O43497-16 ]
ENST00000515765 ; ENSP00000426232 ; ENSG00000006283 . [O43497-7 ]
GeneIDi 8913.
KEGGi hsa:8913.
UCSCi uc002irk.2. human. [O43497-1 ]
uc002irl.2. human.
uc002irw.2. human. [O43497-10 ]

Organism-specific databases

CTDi 8913.
GeneCardsi GC17P048639.
HGNCi HGNC:1394. CACNA1G.
HPAi HPA004714.
MIMi 604065. gene.
neXtProti NX_O43497.
PharmGKBi PA381.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1226.
HOVERGENi HBG050764.
InParanoidi O43497.
KOi K04854.
OMAi QRCRILQ.
OrthoDBi EOG7MKW55.
PhylomeDBi O43497.
TreeFami TF313555.

Enzyme and pathway databases

Reactomei REACT_18312. NCAM1 interactions.

Miscellaneous databases

ChiTaRSi CACNA1G. human.
GeneWikii CACNA1G.
GenomeRNAii 8913.
NextBioi 33500.
PROi O43497.
SOURCEi Search...

Gene expression databases

ArrayExpressi O43497.
Bgeei O43497.
Genevestigatori O43497.

Family and domain databases

Gene3Di 1.20.120.350. 4 hits.
InterProi IPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR005445. VDCC_T_a1su.
IPR002077. VDCCAlpha1.
[Graphical view ]
Pfami PF00520. Ion_trans. 4 hits.
[Graphical view ]
PRINTSi PR00167. CACHANNEL.
PR01629. TVDCCALPHA1.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Inactivation of CACNA1G, a T-type calcium channel gene, by aberrant methylation of its 5' CpG island in human tumors."
    Toyota M., Ho C., Ohe-Toyota M., Baylin S.B., Issa J.-P.J.
    Cancer Res. 59:4535-4541(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), GENE STRUCTURE.
    Tissue: Prostatic carcinoma.
  2. "Structure and alternative splicing of the gene encoding alpha1G, a human brain T calcium channel alpha1 subunit."
    Mittman S., Guo J., Agnew W.S.
    Neurosci. Lett. 274:143-146(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS 4 AND 5).
    Tissue: Brain.
  3. "Molecular cloning and functional expression of ca(v)3.1c, a T-type calcium channel from human brain."
    Cribbs L.L., Gomora J.C., Daud A.N., Lee J.-H., Perez-Reyes E.
    FEBS Lett. 466:54-58(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "Molecular and functional properties of the human alpha1G subunit that forms T-type calcium channels."
    Monteil A., Chemin J., Bourinet E., Mennessier G., Lory P., Nargeot J.
    J. Biol. Chem. 275:6090-6100(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS 1-2 AND 6-13).
    Tissue: Brain.
  5. "Profiling the array of Ca(v)3.1 variants from the human T-type calcium channel gene CACNA1G: alternative structures, developmental expression, and biophysical variations."
    Emerick M.C., Stein R., Kunze R., McNulty M.M., Regan M.R., Hanck D.A., Agnew W.S.
    Proteins 64:320-342(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4; 6; 7; 8; 9; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20; 21; 22; 23; 24; 25; 26; 27; 28; 29; 30; 31; 33; 34 AND 35), DEVELOPMENTAL STAGE.
    Tissue: Brain and Fetal brain.
  6. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9).
  8. "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
    Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
    DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 550-2377 (ISOFORM 13).
    Tissue: Brain.
  9. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  10. "Molecular characterization of a neuronal low-voltage-activated T-type calcium channel."
    Perez-Reyes E., Cribbs L.L., Daud A., Lacerda A.E., Barclay J., Williamson M.P., Fox M., Rees M., Lee J.-H.
    Nature 391:896-900(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1126-1444; 1778-1927 AND 2021-2312.
    Tissue: Brain.

Entry informationi

Entry nameiCAC1G_HUMAN
AccessioniPrimary (citable) accession number: O43497
Secondary accession number(s): D6RA64
, E7EPR0, O43498, O94770, Q19QY8, Q19QY9, Q19QZ0, Q19QZ1, Q19QZ2, Q19QZ3, Q19QZ4, Q19QZ5, Q19QZ6, Q19QZ7, Q19QZ8, Q19QZ9, Q19R00, Q19R01, Q19R02, Q19R03, Q19R04, Q19R05, Q19R06, Q19R07, Q19R08, Q19R09, Q19R10, Q19R11, Q19R12, Q19R13, Q19R15, Q19R16, Q19R17, Q19R18, Q2TAC4, Q9NYU4, Q9NYU5, Q9NYU6, Q9NYU7, Q9NYU8, Q9NYU9, Q9NYV0, Q9NYV1, Q9UHN9, Q9UHP0, Q9ULU6, Q9UNG7, Q9Y5T2, Q9Y5T3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: December 1, 2000
Last modified: September 3, 2014
This is version 129 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi