Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trans-Golgi network integral membrane protein 2

Gene

TGOLN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in regulating membrane traffic to and from trans-Golgi network.

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-432722. Golgi Associated Vesicle Biogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Trans-Golgi network integral membrane protein 2
Alternative name(s):
TGN38 homolog
TGN46
TGN48
Trans-Golgi network protein TGN51
Gene namesi
Name:TGOLN2
Synonyms:TGN46, TGN51
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:15450. TGOLN2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini22 – 381360ExtracellularSequence analysisAdd
BLAST
Transmembranei382 – 40221HelicalSequence analysisAdd
BLAST
Topological domaini403 – 48078CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • endosome Source: GO_Central
  • Golgi apparatus Source: HPA
  • integral component of membrane Source: UniProtKB-KW
  • nucleoplasm Source: HPA
  • plasma membrane Source: UniProtKB-SubCell
  • trans-Golgi network Source: MGI
  • trans-Golgi network transport vesicle Source: GO_Central
  • transport vesicle Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi430 – 4301Y → A: Loss of relocalization to the trans-Golgi. 1 Publication

Organism-specific databases

PharmGKBiPA37959.

Polymorphism and mutation databases

BioMutaiTGOLN2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence analysisAdd
BLAST
Chaini22 – 480459Trans-Golgi network integral membrane protein 2PRO_0000022486Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi39 – 391N-linked (GlcNAc...)Sequence analysis
Modified residuei71 – 711Phosphoserine; by FAM20CCombined sources1 Publication
Glycosylationi82 – 821N-linked (GlcNAc...)Sequence analysis
Glycosylationi96 – 961N-linked (GlcNAc...)Sequence analysis
Glycosylationi152 – 1521N-linked (GlcNAc...)Sequence analysis
Glycosylationi180 – 1801N-linked (GlcNAc...)Sequence analysis
Glycosylationi208 – 2081N-linked (GlcNAc...)Sequence analysis
Modified residuei221 – 2211Phosphoserine; by FAM20C1 Publication
Glycosylationi222 – 2221N-linked (GlcNAc...)Sequence analysis
Modified residuei298 – 2981Phosphoserine; by FAM20C1 Publication
Modified residuei302 – 3021Phosphothreonine; by FAM20C1 Publication
Modified residuei351 – 3511Phosphoserine; by FAM20CCombined sources1 Publication
Glycosylationi373 – 3731N-linked (GlcNAc...)Sequence analysis
Glycosylationi377 – 3771N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiO43493.
MaxQBiO43493.
PaxDbiO43493.
PRIDEiO43493.

PTM databases

iPTMnetiO43493.
PhosphoSiteiO43493.

Expressioni

Tissue specificityi

Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells.

Gene expression databases

BgeeiO43493.
ExpressionAtlasiO43493. baseline and differential.
GenevisibleiO43493. HS.

Organism-specific databases

HPAiCAB011489.
HPA012609.
HPA012723.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
KRTAP10-9P604113EBI-1752146,EBI-10172052
NCK1P163333EBI-1752146,EBI-389883

Protein-protein interaction databases

BioGridi115864. 50 interactions.
IntActiO43493. 19 interactions.
MINTiMINT-3372343.
STRINGi9606.ENSP00000386443.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati54 – 67141Add
BLAST
Repeati68 – 81142Add
BLAST
Repeati82 – 95143Add
BLAST
Repeati96 – 109144Add
BLAST
Repeati110 – 123145Add
BLAST
Repeati124 – 137146Add
BLAST
Repeati138 – 151147Add
BLAST
Repeati152 – 165148Add
BLAST
Repeati166 – 179149Add
BLAST
Repeati180 – 1931410Add
BLAST
Repeati194 – 2071411Add
BLAST
Repeati208 – 2211412Add
BLAST
Repeati222 – 2341313Add
BLAST
Repeati235 – 2491514Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni54 – 24919614 X 14 AA tandem repeatsAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi430 – 4334Endocytosis signal; in isoform TGN46 and isoform TGN48
Motifi437 – 4404Endocytosis signal; in isoform TGN51
Motifi461 – 4644Endocytosis signal; in isoform TGN51

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IXPE. Eukaryota.
ENOG410XUUR. LUCA.
GeneTreeiENSGT00530000064712.
HOGENOMiHOG000089969.
HOVERGENiHBG108564.
InParanoidiO43493.
PhylomeDBiO43493.

Family and domain databases

InterProiIPR026084. TGN38.
[Graphical view]
PANTHERiPTHR23211. PTHR23211. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform TGN51 (identifier: O43493-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRFVVALVLL NVAAAGAVPL LATESVKQEE AGVRPSAGNV STHPSLSQRP
60 70 80 90 100
GGSTKSHPEP QTPKDSPSKS SAEAQTPEDT PNKSGAEAKT QKDSSNKSGA
110 120 130 140 150
EAKTQKGSTS KSGSEAQTTK DSTSKSHPEL QTPKDSTGKS GAEAQTPEDS
160 170 180 190 200
PNRSGAEAKT QKDSPSKSGS EAQTTKDVPN KSGADGQTPK DGSSKSGAED
210 220 230 240 250
QTPKDVPNKS GAEKQTPKDG SNKSGAEEQG PIDGPSKSGA EEQTSKDSPN
260 270 280 290 300
KVVPEQPSRK DHSKPISNPS DNKELPKADT NQLADKGKLS PHAFKTESGE
310 320 330 340 350
ETDLISPPQE EVKSSEPTED VEPKEAEDDD TGPEEGSPPK EEKEKMSGSA
360 370 380 390 400
SSENREGTLS DSTGSEKDDL YPNGSGNGSA ESSHFFAYLV TAAILVAVLY
410 420 430 440 450
IAHHNKRKII AFVLEGKRSK VTRRPKASDY QRLDQKYVLI LNVFPAPPKR
460 470 480
SFLPQVLTEW YIPLEKDERH QWIVLLSFQL
Length:480
Mass (Da):51,113
Last modified:August 21, 2007 - v2
Checksum:i070F6287D35D3601
GO
Isoform TGN46 (identifier: O43493-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-480: YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL → S

Show »
Length:437
Mass (Da):45,880
Checksum:i6F72467FED83A1A3
GO
Isoform TGN48 (identifier: O43493-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-480: YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL → IFFPLSPNRMVYSSGKR

Show »
Length:453
Mass (Da):47,774
Checksum:iE3D3878CB22AC0A2
GO
Isoform 4 (identifier: O43493-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     252-309: Missing.
     437-480: YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL → S

Note: No experimental confirmation available.
Show »
Length:379
Mass (Da):39,563
Checksum:iD8BA8D5EB4EE7562
GO
Isoform 5 (identifier: O43493-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-480: YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL → VRKEEPGPWEG

Note: No experimental confirmation available.
Show »
Length:447
Mass (Da):47,058
Checksum:i557721E4618F7331
GO
Isoform 6 (identifier: O43493-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-161: Missing.
     252-309: Missing.
     437-480: YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL → S

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):29,541
Checksum:i537C9B3CFADF7222
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti30 – 301E → D in AAH08461 (PubMed:15489334).Curated
Sequence conflicti71 – 711S → G in BAD96549 (Ref. 4) Curated
Sequence conflicti74 – 741A → P in BAD96783 (Ref. 4) Curated
Sequence conflicti158 – 1581A → P in AAB96906 (PubMed:9422759).Curated
Sequence conflicti158 – 1581A → P in AAB96907 (PubMed:9422759).Curated
Sequence conflicti158 – 1581A → P in AAB96908 (PubMed:9422759).Curated
Sequence conflicti158 – 1581A → P in AAC39539 (PubMed:9422759).Curated
Sequence conflicti158 – 1581A → P in AAC39541 (PubMed:9422759).Curated
Sequence conflicti158 – 1581A → P in AAC39542 (PubMed:9422759).Curated
Sequence conflicti386 – 3861F → S in CAE45926 (PubMed:17974005).Curated
Sequence conflicti453 – 4531L → F in EAW99536 (Ref. 7) Curated
Sequence conflicti453 – 4531L → F in EAW99539 (Ref. 7) Curated
Isoform TGN48 (identifier: O43493-3)
Sequence conflicti439 – 4391F → S in AAC39541 (PubMed:9422759).Curated
Sequence conflicti441 – 4411L → P in AAC39541 (PubMed:9422759).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti10 – 101L → V.1 Publication
Corresponds to variant rs1128140 [ dbSNP | Ensembl ].
VAR_034724
Natural varianti86 – 861A → G.1 Publication
Corresponds to variant rs1044962 [ dbSNP | Ensembl ].
VAR_034725
Natural varianti91 – 911Q → L.1 Publication
Corresponds to variant rs1044963 [ dbSNP | Ensembl ].
VAR_034726
Natural varianti103 – 1031K → Q.1 Publication
Corresponds to variant rs1044964 [ dbSNP | Ensembl ].
VAR_034727
Natural varianti105 – 1051Q → P.1 Publication
Corresponds to variant rs1044965 [ dbSNP | Ensembl ].
VAR_034728
Natural varianti259 – 2591R → W.4 Publications
Corresponds to variant rs4247303 [ dbSNP | Ensembl ].
VAR_034729
Natural varianti322 – 3221E → G.1 Publication
Corresponds to variant rs1044969 [ dbSNP | Ensembl ].
VAR_034730

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei64 – 16198Missing in isoform 6. 1 PublicationVSP_027469Add
BLAST
Alternative sequencei252 – 30958Missing in isoform 4 and isoform 6. 2 PublicationsVSP_027470Add
BLAST
Alternative sequencei437 – 48044YVLIL…LSFQL → VRKEEPGPWEG in isoform 5. 1 PublicationVSP_027471Add
BLAST
Alternative sequencei437 – 48044YVLIL…LSFQL → S in isoform TGN46, isoform 4 and isoform 6. 6 PublicationsVSP_004454Add
BLAST
Alternative sequencei437 – 48044YVLIL…LSFQL → IFFPLSPNRMVYSSGKR in isoform TGN48. 1 PublicationVSP_004455Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96906.1.
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96907.1.
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96908.1.
U62390 mRNA. Translation: AAC39539.1.
AF027515 mRNA. Translation: AAC39541.1.
AF027516 mRNA. Translation: AAC39542.1.
X94333 mRNA. Translation: CAA64002.1.
AK126465 mRNA. Translation: BAC86559.1.
AK222829 mRNA. Translation: BAD96549.1.
AK223063 mRNA. Translation: BAD96783.1.
AK312479 mRNA. Translation: BAG35383.1.
BX640868 mRNA. Translation: CAE45926.1.
AC093162 Genomic DNA. Translation: AAY24095.1.
CH471053 Genomic DNA. Translation: EAW99535.1.
CH471053 Genomic DNA. Translation: EAW99536.1.
CH471053 Genomic DNA. Translation: EAW99539.1.
BC008461 mRNA. Translation: AAH08461.1.
BC028219 mRNA. Translation: AAH28219.1.
CCDSiCCDS46351.1. [O43493-2]
CCDS56126.1. [O43493-3]
CCDS56127.1. [O43493-4]
RefSeqiNP_001193769.1. NM_001206840.1.
NP_001193770.1. NM_001206841.1.
NP_001193773.1. NM_001206844.1. [O43493-4]
NP_006455.2. NM_006464.3. [O43493-2]
UniGeneiHs.593382.

Genome annotation databases

EnsembliENST00000377386; ENSP00000366603; ENSG00000152291. [O43493-2]
ENST00000398263; ENSP00000381312; ENSG00000152291. [O43493-4]
ENST00000409232; ENSP00000386443; ENSG00000152291. [O43493-3]
ENST00000444342; ENSP00000391190; ENSG00000152291. [O43493-5]
GeneIDi10618.
KEGGihsa:10618.
UCSCiuc002soz.4. human. [O43493-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96906.1.
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96907.1.
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96908.1.
U62390 mRNA. Translation: AAC39539.1.
AF027515 mRNA. Translation: AAC39541.1.
AF027516 mRNA. Translation: AAC39542.1.
X94333 mRNA. Translation: CAA64002.1.
AK126465 mRNA. Translation: BAC86559.1.
AK222829 mRNA. Translation: BAD96549.1.
AK223063 mRNA. Translation: BAD96783.1.
AK312479 mRNA. Translation: BAG35383.1.
BX640868 mRNA. Translation: CAE45926.1.
AC093162 Genomic DNA. Translation: AAY24095.1.
CH471053 Genomic DNA. Translation: EAW99535.1.
CH471053 Genomic DNA. Translation: EAW99536.1.
CH471053 Genomic DNA. Translation: EAW99539.1.
BC008461 mRNA. Translation: AAH08461.1.
BC028219 mRNA. Translation: AAH28219.1.
CCDSiCCDS46351.1. [O43493-2]
CCDS56126.1. [O43493-3]
CCDS56127.1. [O43493-4]
RefSeqiNP_001193769.1. NM_001206840.1.
NP_001193770.1. NM_001206841.1.
NP_001193773.1. NM_001206844.1. [O43493-4]
NP_006455.2. NM_006464.3. [O43493-2]
UniGeneiHs.593382.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115864. 50 interactions.
IntActiO43493. 19 interactions.
MINTiMINT-3372343.
STRINGi9606.ENSP00000386443.

PTM databases

iPTMnetiO43493.
PhosphoSiteiO43493.

Polymorphism and mutation databases

BioMutaiTGOLN2.

Proteomic databases

EPDiO43493.
MaxQBiO43493.
PaxDbiO43493.
PRIDEiO43493.

Protocols and materials databases

DNASUi10618.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000377386; ENSP00000366603; ENSG00000152291. [O43493-2]
ENST00000398263; ENSP00000381312; ENSG00000152291. [O43493-4]
ENST00000409232; ENSP00000386443; ENSG00000152291. [O43493-3]
ENST00000444342; ENSP00000391190; ENSG00000152291. [O43493-5]
GeneIDi10618.
KEGGihsa:10618.
UCSCiuc002soz.4. human. [O43493-1]

Organism-specific databases

CTDi10618.
GeneCardsiTGOLN2.
H-InvDBHIX0022878.
HGNCiHGNC:15450. TGOLN2.
HPAiCAB011489.
HPA012609.
HPA012723.
MIMi603062. gene.
neXtProtiNX_O43493.
PharmGKBiPA37959.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IXPE. Eukaryota.
ENOG410XUUR. LUCA.
GeneTreeiENSGT00530000064712.
HOGENOMiHOG000089969.
HOVERGENiHBG108564.
InParanoidiO43493.
PhylomeDBiO43493.

Enzyme and pathway databases

ReactomeiR-HSA-432722. Golgi Associated Vesicle Biogenesis.

Miscellaneous databases

ChiTaRSiTGOLN2. human.
GeneWikiiTGOLN2.
GenomeRNAii10618.
NextBioi35467559.
PROiO43493.
SOURCEiSearch...

Gene expression databases

BgeeiO43493.
ExpressionAtlasiO43493. baseline and differential.
GenevisibleiO43493. HS.

Family and domain databases

InterProiIPR026084. TGN38.
[Graphical view]
PANTHERiPTHR23211. PTHR23211. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and expression of a novel human trans-Golgi network glycoprotein, TGN51, that contains multiple tyrosine-containing motifs."
    Kain R., Angata K., Kerjaschki D., Fukuda M.
    J. Biol. Chem. 273:981-988(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS TGN51; TGN46 AND TGN48), MUTAGENESIS OF TYR-430, VARIANTS VAL-10; GLY-86; LEU-91; GLN-103; PRO-105 AND GLY-322.
    Tissue: Liver and Placenta.
  2. "Primate homologues of rat TGN38: primary structure, expression and functional implications."
    Ponnambalam S., Girotti M., Yaspo M.-L., Owen C.E., Perry A.C., Suganuma T., Nilsson T., Fried M., Banting G., Warren G.
    J. Cell Sci. 109:675-685(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM TGN46), VARIANT TRP-259.
    Tissue: Fetal liver and Fetal thymus.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS TGN46 AND 6), VARIANT TRP-259.
    Tissue: Uterus.
  4. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM TGN46), VARIANT TRP-259.
    Tissue: Liver.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Cervix.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT TRP-259.
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS TGN46 AND 5).
    Tissue: Prostate.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-71, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
    Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
    Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-71, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-71 AND SER-351, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  15. Cited for: PHOSPHORYLATION AT SER-71; SER-221; SER-298; THR-302 AND SER-351.
  16. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiTGON2_HUMAN
AccessioniPrimary (citable) accession number: O43493
Secondary accession number(s): B2R686
, B8ZZ88, D6W5K3, F8WBK2, O15282, O43492, O43499, O43500, O43501, Q53G68, Q53GV2, Q6MZV1, Q6ZTM7, Q8N6T8, Q92760, Q96QL2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: August 21, 2007
Last modified: March 16, 2016
This is version 139 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.