Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trans-Golgi network integral membrane protein 2

Gene

TGOLN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in regulating membrane traffic to and from trans-Golgi network.

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000152291-MONOMER.
ReactomeiR-HSA-432722. Golgi Associated Vesicle Biogenesis.
R-HSA-6811440. Retrograde transport at the Trans-Golgi-Network.
R-HSA-8856825. Cargo recognition for clathrin-mediated endocytosis.
R-HSA-8856828. Clathrin-mediated endocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
Trans-Golgi network integral membrane protein 2
Alternative name(s):
TGN38 homolog
TGN46
TGN48
Trans-Golgi network protein TGN51
Gene namesi
Name:TGOLN2
Synonyms:TGN46, TGN51
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:15450. TGOLN2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini22 – 381ExtracellularSequence analysisAdd BLAST360
Transmembranei382 – 402HelicalSequence analysisAdd BLAST21
Topological domaini403 – 480CytoplasmicSequence analysisAdd BLAST78

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi430Y → A: Loss of relocalization to the trans-Golgi. 1 Publication1

Organism-specific databases

DisGeNETi10618.
OpenTargetsiENSG00000152291.
PharmGKBiPA37959.

Polymorphism and mutation databases

BioMutaiTGOLN2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000002248622 – 480Trans-Golgi network integral membrane protein 2Add BLAST459

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi39N-linked (GlcNAc...)Sequence analysis1
Modified residuei71Phosphoserine; by FAM20CCombined sources1 Publication1
Glycosylationi82N-linked (GlcNAc...)Sequence analysis1
Glycosylationi96N-linked (GlcNAc...)Sequence analysis1
Glycosylationi152N-linked (GlcNAc...)Sequence analysis1
Glycosylationi180N-linked (GlcNAc...)Sequence analysis1
Glycosylationi208N-linked (GlcNAc...)Sequence analysis1
Modified residuei221Phosphoserine; by FAM20C1 Publication1
Glycosylationi222N-linked (GlcNAc...)Sequence analysis1
Modified residuei298Phosphoserine; by FAM20CCombined sources1 Publication1
Modified residuei302Phosphothreonine; by FAM20C1 Publication1
Modified residuei351Phosphoserine; by FAM20CCombined sources1 Publication1
Glycosylationi373N-linked (GlcNAc...)Sequence analysis1
Glycosylationi377N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiO43493.
MaxQBiO43493.
PaxDbiO43493.
PeptideAtlasiO43493.
PRIDEiO43493.

PTM databases

iPTMnetiO43493.
PhosphoSitePlusiO43493.

Expressioni

Tissue specificityi

Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells.

Gene expression databases

BgeeiENSG00000152291.
ExpressionAtlasiO43493. baseline and differential.
GenevisibleiO43493. HS.

Organism-specific databases

HPAiCAB011489.
HPA012609.
HPA012723.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
KRTAP10-9P604113EBI-1752146,EBI-10172052
NCK1P163333EBI-1752146,EBI-389883

Protein-protein interaction databases

BioGridi115864. 50 interactors.
IntActiO43493. 19 interactors.
MINTiMINT-3372343.
STRINGi9606.ENSP00000386443.

Structurei

3D structure databases

ProteinModelPortaliO43493.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati54 – 671Add BLAST14
Repeati68 – 812Add BLAST14
Repeati82 – 953Add BLAST14
Repeati96 – 1094Add BLAST14
Repeati110 – 1235Add BLAST14
Repeati124 – 1376Add BLAST14
Repeati138 – 1517Add BLAST14
Repeati152 – 1658Add BLAST14
Repeati166 – 1799Add BLAST14
Repeati180 – 19310Add BLAST14
Repeati194 – 20711Add BLAST14
Repeati208 – 22112Add BLAST14
Repeati222 – 23413Add BLAST13
Repeati235 – 24914Add BLAST15

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni54 – 24914 X 14 AA tandem repeatsAdd BLAST196

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi430 – 433Endocytosis signal; in isoform TGN46 and isoform TGN484
Motifi437 – 440Endocytosis signal; in isoform TGN514
Motifi461 – 464Endocytosis signal; in isoform TGN514

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IXPE. Eukaryota.
ENOG410XUUR. LUCA.
GeneTreeiENSGT00530000064712.
HOGENOMiHOG000089969.
HOVERGENiHBG108564.
InParanoidiO43493.
PhylomeDBiO43493.

Family and domain databases

InterProiIPR026084. TGN38.
[Graphical view]
PANTHERiPTHR23211. PTHR23211. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform TGN51 (identifier: O43493-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRFVVALVLL NVAAAGAVPL LATESVKQEE AGVRPSAGNV STHPSLSQRP
60 70 80 90 100
GGSTKSHPEP QTPKDSPSKS SAEAQTPEDT PNKSGAEAKT QKDSSNKSGA
110 120 130 140 150
EAKTQKGSTS KSGSEAQTTK DSTSKSHPEL QTPKDSTGKS GAEAQTPEDS
160 170 180 190 200
PNRSGAEAKT QKDSPSKSGS EAQTTKDVPN KSGADGQTPK DGSSKSGAED
210 220 230 240 250
QTPKDVPNKS GAEKQTPKDG SNKSGAEEQG PIDGPSKSGA EEQTSKDSPN
260 270 280 290 300
KVVPEQPSRK DHSKPISNPS DNKELPKADT NQLADKGKLS PHAFKTESGE
310 320 330 340 350
ETDLISPPQE EVKSSEPTED VEPKEAEDDD TGPEEGSPPK EEKEKMSGSA
360 370 380 390 400
SSENREGTLS DSTGSEKDDL YPNGSGNGSA ESSHFFAYLV TAAILVAVLY
410 420 430 440 450
IAHHNKRKII AFVLEGKRSK VTRRPKASDY QRLDQKYVLI LNVFPAPPKR
460 470 480
SFLPQVLTEW YIPLEKDERH QWIVLLSFQL
Length:480
Mass (Da):51,113
Last modified:August 21, 2007 - v2
Checksum:i070F6287D35D3601
GO
Isoform TGN46 (identifier: O43493-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-480: YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL → S

Show »
Length:437
Mass (Da):45,880
Checksum:i6F72467FED83A1A3
GO
Isoform TGN48 (identifier: O43493-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-480: YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL → IFFPLSPNRMVYSSGKR

Show »
Length:453
Mass (Da):47,774
Checksum:iE3D3878CB22AC0A2
GO
Isoform 4 (identifier: O43493-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     252-309: Missing.
     437-480: YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL → S

Note: No experimental confirmation available.
Show »
Length:379
Mass (Da):39,563
Checksum:iD8BA8D5EB4EE7562
GO
Isoform 5 (identifier: O43493-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-480: YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL → VRKEEPGPWEG

Note: No experimental confirmation available.
Show »
Length:447
Mass (Da):47,058
Checksum:i557721E4618F7331
GO
Isoform 6 (identifier: O43493-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-161: Missing.
     252-309: Missing.
     437-480: YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL → S

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):29,541
Checksum:i537C9B3CFADF7222
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti30E → D in AAH08461 (PubMed:15489334).Curated1
Sequence conflicti71S → G in BAD96549 (Ref. 4) Curated1
Sequence conflicti74A → P in BAD96783 (Ref. 4) Curated1
Sequence conflicti158A → P in AAB96906 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAB96907 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAB96908 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAC39539 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAC39541 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAC39542 (PubMed:9422759).Curated1
Sequence conflicti386F → S in CAE45926 (PubMed:17974005).Curated1
Sequence conflicti453L → F in EAW99536 (Ref. 7) Curated1
Sequence conflicti453L → F in EAW99539 (Ref. 7) Curated1
Isoform TGN48 (identifier: O43493-3)
Sequence conflicti439F → S in AAC39541 (PubMed:9422759).Curated1
Sequence conflicti441L → P in AAC39541 (PubMed:9422759).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03472410L → V.1 PublicationCorresponds to variant rs1128140dbSNPEnsembl.1
Natural variantiVAR_03472586A → G.1 PublicationCorresponds to variant rs1044962dbSNPEnsembl.1
Natural variantiVAR_03472691Q → L.1 PublicationCorresponds to variant rs1044963dbSNPEnsembl.1
Natural variantiVAR_034727103K → Q.1 PublicationCorresponds to variant rs1044964dbSNPEnsembl.1
Natural variantiVAR_034728105Q → P.1 PublicationCorresponds to variant rs1044965dbSNPEnsembl.1
Natural variantiVAR_034729259R → W.4 PublicationsCorresponds to variant rs4247303dbSNPEnsembl.1
Natural variantiVAR_034730322E → G.1 PublicationCorresponds to variant rs1044969dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02746964 – 161Missing in isoform 6. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_027470252 – 309Missing in isoform 4 and isoform 6. 2 PublicationsAdd BLAST58
Alternative sequenceiVSP_027471437 – 480YVLIL…LSFQL → VRKEEPGPWEG in isoform 5. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_004454437 – 480YVLIL…LSFQL → S in isoform TGN46, isoform 4 and isoform 6. 6 PublicationsAdd BLAST44
Alternative sequenceiVSP_004455437 – 480YVLIL…LSFQL → IFFPLSPNRMVYSSGKR in isoform TGN48. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96906.1.
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96907.1.
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96908.1.
U62390 mRNA. Translation: AAC39539.1.
AF027515 mRNA. Translation: AAC39541.1.
AF027516 mRNA. Translation: AAC39542.1.
X94333 mRNA. Translation: CAA64002.1.
AK126465 mRNA. Translation: BAC86559.1.
AK222829 mRNA. Translation: BAD96549.1.
AK223063 mRNA. Translation: BAD96783.1.
AK312479 mRNA. Translation: BAG35383.1.
BX640868 mRNA. Translation: CAE45926.1.
AC093162 Genomic DNA. Translation: AAY24095.1.
CH471053 Genomic DNA. Translation: EAW99535.1.
CH471053 Genomic DNA. Translation: EAW99536.1.
CH471053 Genomic DNA. Translation: EAW99539.1.
BC008461 mRNA. Translation: AAH08461.1.
BC028219 mRNA. Translation: AAH28219.1.
CCDSiCCDS46351.1. [O43493-2]
CCDS56126.1. [O43493-3]
CCDS56127.1. [O43493-4]
RefSeqiNP_001193769.1. NM_001206840.1.
NP_001193770.1. NM_001206841.1.
NP_001193773.1. NM_001206844.1. [O43493-4]
NP_006455.2. NM_006464.3. [O43493-2]
UniGeneiHs.593382.

Genome annotation databases

EnsembliENST00000377386; ENSP00000366603; ENSG00000152291. [O43493-2]
ENST00000398263; ENSP00000381312; ENSG00000152291. [O43493-4]
ENST00000409232; ENSP00000386443; ENSG00000152291. [O43493-3]
ENST00000444342; ENSP00000391190; ENSG00000152291. [O43493-5]
GeneIDi10618.
KEGGihsa:10618.
UCSCiuc002soz.4. human. [O43493-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96906.1.
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96907.1.
AF029316
, AF029313, AF029314, AF029315 Genomic DNA. Translation: AAB96908.1.
U62390 mRNA. Translation: AAC39539.1.
AF027515 mRNA. Translation: AAC39541.1.
AF027516 mRNA. Translation: AAC39542.1.
X94333 mRNA. Translation: CAA64002.1.
AK126465 mRNA. Translation: BAC86559.1.
AK222829 mRNA. Translation: BAD96549.1.
AK223063 mRNA. Translation: BAD96783.1.
AK312479 mRNA. Translation: BAG35383.1.
BX640868 mRNA. Translation: CAE45926.1.
AC093162 Genomic DNA. Translation: AAY24095.1.
CH471053 Genomic DNA. Translation: EAW99535.1.
CH471053 Genomic DNA. Translation: EAW99536.1.
CH471053 Genomic DNA. Translation: EAW99539.1.
BC008461 mRNA. Translation: AAH08461.1.
BC028219 mRNA. Translation: AAH28219.1.
CCDSiCCDS46351.1. [O43493-2]
CCDS56126.1. [O43493-3]
CCDS56127.1. [O43493-4]
RefSeqiNP_001193769.1. NM_001206840.1.
NP_001193770.1. NM_001206841.1.
NP_001193773.1. NM_001206844.1. [O43493-4]
NP_006455.2. NM_006464.3. [O43493-2]
UniGeneiHs.593382.

3D structure databases

ProteinModelPortaliO43493.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115864. 50 interactors.
IntActiO43493. 19 interactors.
MINTiMINT-3372343.
STRINGi9606.ENSP00000386443.

PTM databases

iPTMnetiO43493.
PhosphoSitePlusiO43493.

Polymorphism and mutation databases

BioMutaiTGOLN2.

Proteomic databases

EPDiO43493.
MaxQBiO43493.
PaxDbiO43493.
PeptideAtlasiO43493.
PRIDEiO43493.

Protocols and materials databases

DNASUi10618.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000377386; ENSP00000366603; ENSG00000152291. [O43493-2]
ENST00000398263; ENSP00000381312; ENSG00000152291. [O43493-4]
ENST00000409232; ENSP00000386443; ENSG00000152291. [O43493-3]
ENST00000444342; ENSP00000391190; ENSG00000152291. [O43493-5]
GeneIDi10618.
KEGGihsa:10618.
UCSCiuc002soz.4. human. [O43493-1]

Organism-specific databases

CTDi10618.
DisGeNETi10618.
GeneCardsiTGOLN2.
H-InvDBHIX0022878.
HGNCiHGNC:15450. TGOLN2.
HPAiCAB011489.
HPA012609.
HPA012723.
MIMi603062. gene.
neXtProtiNX_O43493.
OpenTargetsiENSG00000152291.
PharmGKBiPA37959.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IXPE. Eukaryota.
ENOG410XUUR. LUCA.
GeneTreeiENSGT00530000064712.
HOGENOMiHOG000089969.
HOVERGENiHBG108564.
InParanoidiO43493.
PhylomeDBiO43493.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000152291-MONOMER.
ReactomeiR-HSA-432722. Golgi Associated Vesicle Biogenesis.
R-HSA-6811440. Retrograde transport at the Trans-Golgi-Network.
R-HSA-8856825. Cargo recognition for clathrin-mediated endocytosis.
R-HSA-8856828. Clathrin-mediated endocytosis.

Miscellaneous databases

ChiTaRSiTGOLN2. human.
GeneWikiiTGOLN2.
GenomeRNAii10618.
PROiO43493.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000152291.
ExpressionAtlasiO43493. baseline and differential.
GenevisibleiO43493. HS.

Family and domain databases

InterProiIPR026084. TGN38.
[Graphical view]
PANTHERiPTHR23211. PTHR23211. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiTGON2_HUMAN
AccessioniPrimary (citable) accession number: O43493
Secondary accession number(s): B2R686
, B8ZZ88, D6W5K3, F8WBK2, O15282, O43492, O43499, O43500, O43501, Q53G68, Q53GV2, Q6MZV1, Q6ZTM7, Q8N6T8, Q92760, Q96QL2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: August 21, 2007
Last modified: November 2, 2016
This is version 144 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.