Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptidyl-prolyl cis-trans isomerase H

Gene

PPIH

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome. May act as a chaperone.3 Publications

Catalytic activityi

Peptidylproline (omega=180) = peptidylproline (omega=0).

Enzyme regulationi

Inhibited by cyclosporin A.

GO - Molecular functioni

  • cyclosporin A binding Source: ProtInc
  • peptidyl-prolyl cis-trans isomerase activity Source: BHF-UCL
  • ribonucleoprotein complex binding Source: BHF-UCL

GO - Biological processi

  • mRNA splicing, via spliceosome Source: BHF-UCL
  • positive regulation of viral genome replication Source: UniProtKB
  • protein complex assembly Source: ProtInc
  • protein folding Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Chaperone, Isomerase, Rotamase

Keywords - Biological processi

mRNA processing, mRNA splicing

Enzyme and pathway databases

BioCyciZFISH:HS10424-MONOMER.
BRENDAi5.2.1.8. 2681.
ReactomeiR-HSA-72163. mRNA Splicing - Major Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase H (EC:5.2.1.8)
Short name:
PPIase H
Alternative name(s):
Rotamase H
Small nuclear ribonucleoprotein particle-specific cyclophilin H
Short name:
CypH
U-snRNP-associated cyclophilin SnuCyp-20
Short name:
USA-CYP
Gene namesi
Name:PPIH
Synonyms:CYP20, CYPH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:14651. PPIH.

Subcellular locationi

  • Nucleus speckle 1 Publication
  • Cytoplasm 1 Publication

  • Note: Colocalizes with spliceosomal snRNPs. A small proportion may also be cytoplasmic.

GO - Cellular componenti

  • cytoplasm Source: BHF-UCL
  • nuclear speck Source: BHF-UCL
  • nucleoplasm Source: Reactome
  • spliceosomal complex Source: BHF-UCL
  • U4/U6 snRNP Source: BHF-UCL
  • U4/U6 x U5 tri-snRNP complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus, Spliceosome

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi133W → F: Abolishes inhibition by cyclosporin A. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000171960.
PharmGKBiPA33586.

Chemistry databases

DrugBankiDB00172. L-Proline.

Polymorphism and mutation databases

BioMutaiPPIH.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000641622 – 177Peptidyl-prolyl cis-trans isomerase HAdd BLAST176

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiO43447.
PaxDbiO43447.
PeptideAtlasiO43447.
PRIDEiO43447.

PTM databases

iPTMnetiO43447.
PhosphoSitePlusiO43447.

Expressioni

Gene expression databases

BgeeiENSG00000171960.
CleanExiHS_PPIH.
ExpressionAtlasiO43447. baseline and differential.
GenevisibleiO43447. HS.

Organism-specific databases

HPAiHPA059019.

Interactioni

Subunit structurei

Interacts directly with PRPF4. Part of a heteromeric complex containing PPIH, PRPF3 and PRPF4 that is stable in the absence of RNA. Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, DDX23, CD2BP2, PPIH, SNU13, EFTUD2, SART1 and USP39. Heterodimer with PRPF18.5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
N4BP2L2Q928025EBI-1055615,EBI-2514973
PRPF18Q996334EBI-1055615,EBI-2798416
PRPF4O431722EBI-1055615,EBI-718395
XIAPP981704EBI-1055615,EBI-517127

Protein-protein interaction databases

BioGridi115728. 27 interactors.
IntActiO43447. 18 interactors.
MINTiMINT-270606.
STRINGi9606.ENSP00000306614.

Chemistry databases

BindingDBiO43447.

Structurei

Secondary structure

1177
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi12 – 19Combined sources8
Beta strandi22 – 31Combined sources10
Turni33 – 35Combined sources3
Helixi37 – 48Combined sources12
Beta strandi67 – 69Combined sources3
Turni70 – 72Combined sources3
Beta strandi73 – 76Combined sources4
Turni79 – 81Combined sources3
Beta strandi82 – 84Combined sources3
Beta strandi109 – 112Combined sources4
Beta strandi124 – 129Combined sources6
Helixi132 – 134Combined sources3
Turni135 – 137Combined sources3
Beta strandi140 – 146Combined sources7
Helixi148 – 155Combined sources8
Helixi161 – 163Combined sources3
Beta strandi165 – 167Combined sources3
Beta strandi169 – 176Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1MZWX-ray2.00A1-177[»]
1QOIX-ray2.00A1-177[»]
ProteinModelPortaliO43447.
SMRiO43447.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO43447.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini14 – 176PPIase cyclophilin-typePROSITE-ProRule annotationAdd BLAST163

Sequence similaritiesi

Contains 1 PPIase cyclophilin-type domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0546. Eukaryota.
COG0652. LUCA.
GeneTreeiENSGT00760000119072.
HOGENOMiHOG000065981.
HOVERGENiHBG001065.
InParanoidiO43447.
KOiK09567.
OMAiPTWNQIQ.
OrthoDBiEOG091G0BGL.
PhylomeDBiO43447.
TreeFamiTF312958.

Family and domain databases

Gene3Di2.40.100.10. 1 hit.
InterProiIPR029000. Cyclophilin-like_dom.
IPR024936. Cyclophilin-type_PPIase.
IPR020892. Cyclophilin-type_PPIase_CS.
IPR002130. Cyclophilin-type_PPIase_dom.
[Graphical view]
PANTHERiPTHR11071. PTHR11071. 1 hit.
PfamiPF00160. Pro_isomerase. 1 hit.
[Graphical view]
PIRSFiPIRSF001467. Peptidylpro_ismrse. 1 hit.
PRINTSiPR00153. CSAPPISMRASE.
SUPFAMiSSF50891. SSF50891. 1 hit.
PROSITEiPS00170. CSA_PPIASE_1. 1 hit.
PS50072. CSA_PPIASE_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43447-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVANSSPVN PVVFFDVSIG GQEVGRMKIE LFADVVPKTA ENFRQFCTGE
60 70 80 90 100
FRKDGVPIGY KGSTFHRVIK DFMIQGGDFV NGDGTGVASI YRGPFADENF
110 120 130 140 150
KLRHSAPGLL SMANSGPSTN GCQFFITCSK CDWLDGKHVV FGKIIDGLLV
160 170
MRKIENVPTG PNNKPKLPVV ISQCGEM
Length:177
Mass (Da):19,208
Last modified:June 1, 1998 - v1
Checksum:i566BCE6361E0F339
GO
Isoform 2 (identifier: O43447-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEF → MIAGDSDR

Note: No experimental confirmation available.
Show »
Length:134
Mass (Da):14,492
Checksum:iE55350B73F8A1C3B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0565871 – 51MAVAN…CTGEF → MIAGDSDR in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF016371 mRNA. Translation: AAC51927.1.
AF036331 mRNA. Translation: AAC60793.1.
AK294288 mRNA. Translation: BAH11725.1.
AC098484 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07155.1.
BC003412 mRNA. Translation: AAH03412.1.
CCDSiCCDS469.1. [O43447-1]
CCDS81308.1. [O43447-2]
RefSeqiNP_001317439.1. NM_001330510.1.
NP_006338.1. NM_006347.3. [O43447-1]
XP_005270419.1. XM_005270362.1. [O43447-1]
XP_016855546.1. XM_017000057.1. [O43447-1]
XP_016855547.1. XM_017000058.1. [O43447-2]
XP_016855548.1. XM_017000059.1. [O43447-2]
UniGeneiHs.256639.
Hs.729213.

Genome annotation databases

EnsembliENST00000304979; ENSP00000306614; ENSG00000171960. [O43447-1]
ENST00000372550; ENSP00000361630; ENSG00000171960. [O43447-2]
GeneIDi10465.
KEGGihsa:10465.
UCSCiuc009vwl.3. human. [O43447-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF016371 mRNA. Translation: AAC51927.1.
AF036331 mRNA. Translation: AAC60793.1.
AK294288 mRNA. Translation: BAH11725.1.
AC098484 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07155.1.
BC003412 mRNA. Translation: AAH03412.1.
CCDSiCCDS469.1. [O43447-1]
CCDS81308.1. [O43447-2]
RefSeqiNP_001317439.1. NM_001330510.1.
NP_006338.1. NM_006347.3. [O43447-1]
XP_005270419.1. XM_005270362.1. [O43447-1]
XP_016855546.1. XM_017000057.1. [O43447-1]
XP_016855547.1. XM_017000058.1. [O43447-2]
XP_016855548.1. XM_017000059.1. [O43447-2]
UniGeneiHs.256639.
Hs.729213.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1MZWX-ray2.00A1-177[»]
1QOIX-ray2.00A1-177[»]
ProteinModelPortaliO43447.
SMRiO43447.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115728. 27 interactors.
IntActiO43447. 18 interactors.
MINTiMINT-270606.
STRINGi9606.ENSP00000306614.

Chemistry databases

BindingDBiO43447.
DrugBankiDB00172. L-Proline.

PTM databases

iPTMnetiO43447.
PhosphoSitePlusiO43447.

Polymorphism and mutation databases

BioMutaiPPIH.

Proteomic databases

EPDiO43447.
PaxDbiO43447.
PeptideAtlasiO43447.
PRIDEiO43447.

Protocols and materials databases

DNASUi10465.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304979; ENSP00000306614; ENSG00000171960. [O43447-1]
ENST00000372550; ENSP00000361630; ENSG00000171960. [O43447-2]
GeneIDi10465.
KEGGihsa:10465.
UCSCiuc009vwl.3. human. [O43447-1]

Organism-specific databases

CTDi10465.
GeneCardsiPPIH.
HGNCiHGNC:14651. PPIH.
HPAiHPA059019.
MIMi606095. gene.
neXtProtiNX_O43447.
OpenTargetsiENSG00000171960.
PharmGKBiPA33586.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0546. Eukaryota.
COG0652. LUCA.
GeneTreeiENSGT00760000119072.
HOGENOMiHOG000065981.
HOVERGENiHBG001065.
InParanoidiO43447.
KOiK09567.
OMAiPTWNQIQ.
OrthoDBiEOG091G0BGL.
PhylomeDBiO43447.
TreeFamiTF312958.

Enzyme and pathway databases

BioCyciZFISH:HS10424-MONOMER.
BRENDAi5.2.1.8. 2681.
ReactomeiR-HSA-72163. mRNA Splicing - Major Pathway.

Miscellaneous databases

ChiTaRSiPPIH. human.
EvolutionaryTraceiO43447.
GeneWikiiPPIH.
GenomeRNAii10465.
PROiO43447.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171960.
CleanExiHS_PPIH.
ExpressionAtlasiO43447. baseline and differential.
GenevisibleiO43447. HS.

Family and domain databases

Gene3Di2.40.100.10. 1 hit.
InterProiIPR029000. Cyclophilin-like_dom.
IPR024936. Cyclophilin-type_PPIase.
IPR020892. Cyclophilin-type_PPIase_CS.
IPR002130. Cyclophilin-type_PPIase_dom.
[Graphical view]
PANTHERiPTHR11071. PTHR11071. 1 hit.
PfamiPF00160. Pro_isomerase. 1 hit.
[Graphical view]
PIRSFiPIRSF001467. Peptidylpro_ismrse. 1 hit.
PRINTSiPR00153. CSAPPISMRASE.
SUPFAMiSSF50891. SSF50891. 1 hit.
PROSITEiPS00170. CSA_PPIASE_1. 1 hit.
PS50072. CSA_PPIASE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPPIH_HUMAN
AccessioniPrimary (citable) accession number: O43447
Secondary accession number(s): A6NNE7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2003
Last sequence update: June 1, 1998
Last modified: November 30, 2016
This is version 152 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.