O43439 (MTG8R_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein CBFA2T2 Alternative name(s): ETO homologous on chromosome 20 MTG8-like protein MTG8-related protein 1 Myeloid translocation-related protein 1 p85 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 604 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May function as a complex with the chimeric protein RUNX1/AML1-CBFA2T1/MTG8 which is produced in acute myeloid leukemia with the chromosomal translocation t(8;21). May thus be involved in the repression of AML1-dependent transcription and the induction of G-CSF/CSF3-dependent cell growth. May be a tumor suppressor gene candidate involved in myeloid tumors with the deletion of the 20q11 region. |
| Subunit structure | Homooligomer and heterooligomer with MTG8. Forms a heterooligomer with the RUNX1/AML1-CBFA2T1/MTG8 chimeric protein, via an interaction with MTG8. Heterodimer with CBFA2T3. |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Ubiquitously expressed in fetal and adult tissues. Highly expressed in adult brain, heart, lung, kidney, lymph node, appendix, thymus, testis, uterus, small intestine, prostate and thymus. Ref.1 Ref.2 Ref.3 Ref.8 |
| Sequence similarities | Belongs to the CBFA2T family. Contains 1 MYND-type zinc finger. Contains 1 TAFH (NHR1) domain. |
| Sequence caution | The sequence AAC19378.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Zinc-finger |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | negative regulation of neuron projection development Inferred from sequence or structural similarity. Source: UniProtKB positive regulation of neuron projection developmentInferred from direct assay. Source: UniProtKB |
| Cellular component | nucleus Inferred from direct assay. Source: UniProtKB |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct sequence-specific DNA binding transcription factor activityInferred from electronic annotation. Source: InterPro transcription corepressor activityInferred from direct assay. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| MDFI | Q99750 | 3 | EBI-748628,EBI-724076 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43439-1) Also known as: MTGR1b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43439-2) Also known as: MTGR1a; EHT; The sequence of this isoform differs from the canonical sequence as follows: 1-29: Missing. | ||||||
| Isoform 3 (identifier: O43439-3) The sequence of this isoform differs from the canonical sequence as follows: 1-29: Missing. 240-292: RREENSFDRD...QFHPTPPPLQ → SCIIHLKSMG...SLRSTVLPFP 293-604: Missing. | ||||||
| Isoform 4 (identifier: O43439-4) The sequence of this isoform differs from the canonical sequence as follows: 1-20: MAKESGISLKEIQVLARQWK → MGFHHVGQARLELLTSGDLPALASQRAGIT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 604 | 604 | Protein CBFA2T2 | PRO_0000218301 | |||||
Regions | |||||||||
| Domain | 113 – 208 | 96 | TAFH | ||||||
| Zinc finger | 517 – 553 | 37 | MYND-type | ||||||
| Coiled coil | 451 – 491 | 41 | Potential | ||||||
| Compositional bias | 33 – 97 | 65 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 33 | 1 | Phosphoserine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 29 | 29 | Missing in isoform 2 and isoform 3. | VSP_008121 | |||||
| Alternative sequence | 1 – 20 | 20 | MAKES…ARQWK → MGFHHVGQARLELLTSGDLP ALASQRAGIT in isoform 4. | VSP_008122 | |||||
| Alternative sequence | 240 – 292 | 53 | RREEN…PPPLQ → SCIIHLKSMGVASRHEYFSG TLQMPAHPVRNSTLENLWVD CSRSLRSTVLPFP in isoform 3. | VSP_008123 | |||||
| Alternative sequence | 293 – 604 | 312 | Missing in isoform 3. | VSP_008124 | |||||
Experimental info | |||||||||
| Sequence conflict | 31 | 1 | P → H in AAH15066. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "EHT, a new member of the MTG8/ETO gene family, maps on 20q11 region and is deleted in acute myeloid leukemias." Fracchiolla N.S., Colombo G., Finelli P., Maiolo A.T., Neri A. Blood 92:3481-3484(1998) [PubMed: 9787195] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. |
| [2] | "The AML1-MTG8 leukemic fusion protein forms a complex with a novel member of the MTG8(ETO/CDR) family, MTGR1." Kitabayashi I., Ida K., Morohoshi F., Yokoyama A., Mitsuhashi N., Shimizu K., Nomura N., Hayashi Y., Ohki M. Mol. Cell. Biol. 18:846-858(1998) [PubMed: 9447981] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, PHOSPHORYLATION, INTERACTION WITH MTG8 AND AML1-MTG8. Tissue: Leukemia. |
| [3] | "Structure and expression pattern of a human MTG8/ETO family gene, MTGR1." Morohoshi F., Mitani S., Mitsuhashi N., Kitabayashi I., Takahashi E., Suzuki M., Munakata N., Ohki M. Gene 241:287-295(2000) [PubMed: 10675041] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Tissue: Leukemia. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Eye, Ovary and Prostate. |
| [8] | "CBFA2T1, a gene rearranged in human leukemia, is a member of a multigene family." Calabi F., Cilli V. Genomics 52:332-341(1998) [PubMed: 9790752] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 22-604, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Tissue: Fetal brain and Retina. |
| [9] | "The transcriptional corepressor MTG16a contains a novel nucleolar targeting sequence deranged in t(16; 21)-positive myeloid malignancies." Hoogeveen A.T., Rossetti S., Stoyanova V., Schonkeren J., Fenaroli A., Schiaffonati L., van Unen L., Sacchi N. Oncogene 21:6703-6712(2002) [PubMed: 12242670] [Abstract] Cited for: INTERACTION WITH CBFA2T3. |
| [10] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF039200 mRNA. Translation: AAC17499.1. AF068266 mRNA. Translation: AAC19378.1. Different initiation. AF013970 mRNA. Translation: AAC39841.1. AF069747 mRNA. Translation: AAD02825.1. AF076461 AF076460 Genomic DNA. Translation: AAD41221.1.AK314159 mRNA. Translation: BAG36843.1. AL034421, AL121906 Genomic DNA. Translation: CAI19280.2. AL034421, AL121906 Genomic DNA. Translation: CAI19281.1. AL121906, AL034421 Genomic DNA. Translation: CAI22125.1. AL121906, AL034421 Genomic DNA. Translation: CAI22130.1. AL121906, AL034421 Genomic DNA. Translation: CAM28282.1. CH471077 Genomic DNA. Translation: EAW76311.1. BC015066 mRNA. Translation: AAH15066.1. BC016298 mRNA. Translation: AAH16298.2. BC040344 mRNA. Translation: AAH40344.1. AF052210 mRNA. Translation: AAC64699.1. |
| IPI | IPI00179452. IPI00180725. IPI00332991. IPI00339253. |
| RefSeq | NP_001028171.1. NM_001032999.2. NP_001034798.1. NM_001039709.1. NP_005084.1. NM_005093.3. |
| UniGene | Hs.153934. |
3D structure databases | |
| ProteinModelPortal | O43439. |
| SMR | O43439. Positions 112-215, 336-392, 421-459, 497-543. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O43439. 9 interactions. |
| MINT | MINT-2865952. |
| STRING | O43439. |
PTM databases | |
| PhosphoSite | O43439. |
Proteomic databases | |
| PRIDE | O43439. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000346541; ENSP00000262653; ENSG00000078699. ENST00000375279; ENSP00000364428; ENSG00000078699. |
| GeneID | 9139. |
| KEGG | hsa:9139. |
| UCSC | uc002wze.1. human. uc002wzg.1. human. |
Organism-specific databases | |
| CTD | 9139. |
| GeneCards | GC20P032077. |
| HGNC | HGNC:1536. CBFA2T2. |
| MIM | 603672. gene. |
| neXtProt | NX_O43439. |
| PharmGKB | PA26112. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG000169. |
| OMA | DSQREFN. |
| OrthoDB | EOG4548Z9. |
Gene expression databases | |
| ArrayExpress | O43439. |
| Bgee | O43439. |
| Genevestigator | O43439. |
| GermOnline | ENSG00000078699. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013289. ETO. IPR013291. MTGR1. IPR014896. NHR2. IPR003894. TAFH_NHR1. IPR002893. Znf_MYND. [Graphical view] |
| Pfam | PF08788. NHR2. 1 hit. PF07531. TAFH. 1 hit. PF01753. zf-MYND. 1 hit. [Graphical view] |
| PRINTS | PR01875. ETOFAMILY. PR01877. MTGR1PROTEIN. |
| SMART | SM00549. TAFH. 1 hit. [Graphical view] |
| PROSITE | PS51119. TAFH. 1 hit. PS01360. ZF_MYND_1. 1 hit. PS50865. ZF_MYND_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 34271. |
| SOURCE | Search... |
Entry information
| Entry name | MTG8R_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43439 Secondary accession number(s): B2RAE6 Q9UP24 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with