Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O43439

- MTG8R_HUMAN

UniProt

O43439 - MTG8R_HUMAN

Protein

Protein CBFA2T2

Gene

CBFA2T2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 126 (01 Oct 2014)
      Sequence version 1 (01 Jun 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May function as a complex with the chimeric protein RUNX1/AML1-CBFA2T1/MTG8 which is produced in acute myeloid leukemia with the chromosomal translocation t(8;21). May thus be involved in the repression of AML1-dependent transcription and the induction of G-CSF/CSF3-dependent cell growth. May be a tumor suppressor gene candidate involved in myeloid tumors with the deletion of the 20q11 region.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri517 – 55337MYND-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. protein binding Source: IntAct
    3. sequence-specific DNA binding transcription factor activity Source: InterPro
    4. transcription corepressor activity Source: UniProtKB

    GO - Biological processi

    1. epithelial cell differentiation Source: Ensembl
    2. negative regulation of neuron projection development Source: UniProtKB
    3. negative regulation of transcription, DNA-templated Source: Ensembl
    4. positive regulation of neuron projection development Source: UniProtKB
    5. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein CBFA2T2
    Alternative name(s):
    ETO homologous on chromosome 20
    MTG8-like protein
    MTG8-related protein 1
    Myeloid translocation-related protein 1
    p85
    Gene namesi
    Name:CBFA2T2
    Synonyms:EHT, MTGR1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:1536. CBFA2T2.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26112.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 604604Protein CBFA2T2PRO_0000218301Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei409 – 4091Phosphoserine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO43439.
    PaxDbiO43439.
    PRIDEiO43439.

    PTM databases

    PhosphoSiteiO43439.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed in fetal and adult tissues. Highly expressed in adult brain, heart, lung, kidney, lymph node, appendix, thymus, testis, uterus, small intestine, prostate and thymus.4 Publications

    Gene expression databases

    ArrayExpressiO43439.
    BgeeiO43439.
    GenevestigatoriO43439.

    Organism-specific databases

    HPAiHPA060523.

    Interactioni

    Subunit structurei

    Homooligomer and heterooligomer with MTG8. Forms a heterooligomer with the RUNX1/AML1-CBFA2T1/MTG8 chimeric protein, via an interaction with MTG8. Heterodimer with CBFA2T3.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    MDFIQ997504EBI-748628,EBI-724076

    Protein-protein interaction databases

    BioGridi114586. 20 interactions.
    IntActiO43439. 9 interactions.
    MINTiMINT-2865952.

    Structurei

    3D structure databases

    ProteinModelPortaliO43439.
    SMRiO43439. Positions 112-209, 336-392, 429-459, 497-543.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini113 – 20896TAFHPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili451 – 49141Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi33 – 9765Pro-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the CBFA2T family.Curated
    Contains 1 MYND-type zinc finger.PROSITE-ProRule annotation
    Contains 1 TAFH (NHR1) domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri517 – 55337MYND-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG79810.
    HOVERGENiHBG000169.
    OMAiSEYRGTE.
    OrthoDBiEOG70W3D2.
    PhylomeDBiO43439.
    TreeFamiTF106303.

    Family and domain databases

    InterProiIPR013289. ETO.
    IPR013291. MTGR1.
    IPR014896. NHR2.
    IPR003894. TAFH_NHR1.
    IPR002893. Znf_MYND.
    [Graphical view]
    PfamiPF08788. NHR2. 1 hit.
    PF07531. TAFH. 1 hit.
    PF01753. zf-MYND. 1 hit.
    [Graphical view]
    PRINTSiPR01875. ETOFAMILY.
    PR01877. MTGR1PROTEIN.
    SMARTiSM00549. TAFH. 1 hit.
    [Graphical view]
    PROSITEiPS51119. TAFH. 1 hit.
    PS01360. ZF_MYND_1. 1 hit.
    PS50865. ZF_MYND_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O43439-1) [UniParc]FASTAAdd to Basket

    Also known as: MTGR1b

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAKESGISLK EIQVLARQWK VGPEKRVPAM PGSPVEVKIQ SRSSPPTMPP    50
    LPPINPGGPR PVSFTPTALS NGINHSPPTL NGAPSPPQRF SNGPASSTSS 100
    ALTNQQLPAT CGARQLSKLK RFLTTLQQFG NDISPEIGEK VRTLVLALVN 150
    STVTIEEFHC KLQEATNFPL RPFVIPFLKA NLPLLQRELL HCARAAKQTP 200
    SQYLAQHEHL LLNTSIASPA DSSELLMEVH GNGKRPSPER REENSFDRDT 250
    IAPEPPAKRV CTISPAPRHS PALTVPLMNP GGQFHPTPPP LQHYTLEDIA 300
    TSHLYREPNK MLEHREVRDR HHSLGLNGGY QDELVDHRLT EREWADEWKH 350
    LDHALNCIME MVEKTRRSMA VLRRCQESDR EELNYWKRRY NENTELRKTG 400
    TELVSRQHSP GSADSLSNDS QREFNSRPGT GYVPVEFWKK TEEAVNKVKI 450
    QAMSEVQKAV AEAEQKAFEV IATERARMEQ TIADVKRQAA EDAFLVINEQ 500
    EESTENCWNC GRKASETCSG CNIARYCGSF CQHKDWERHH RLCGQNLHGQ 550
    SPHGQGRPLL PVGRGSSARS ADCSVPSPAL DKTSATTSRS STPASVTAID 600
    TNGL 604
    Length:604
    Mass (Da):67,133
    Last modified:June 1, 1998 - v1
    Checksum:i1E55618844908169
    GO
    Isoform 2 (identifier: O43439-2) [UniParc]FASTAAdd to Basket

    Also known as: MTGR1a, EHT

    The sequence of this isoform differs from the canonical sequence as follows:
         1-29: Missing.

    Show »
    Length:575
    Mass (Da):63,901
    Checksum:i7B11331102BD85DB
    GO
    Isoform 3 (identifier: O43439-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-29: Missing.
         240-292: RREENSFDRD...QFHPTPPPLQ → SCIIHLKSMG...SLRSTVLPFP
         293-604: Missing.

    Show »
    Length:263
    Mass (Da):28,567
    Checksum:i6DB58D27B5066D25
    GO
    Isoform 4 (identifier: O43439-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MAKESGISLKEIQVLARQWK → MGFHHVGQARLELLTSGDLPALASQRAGIT

    Show »
    Length:614
    Mass (Da):67,965
    Checksum:iF5373F002C17ACB4
    GO
    Isoform 5 (identifier: O43439-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-21: MAKESGISLKEIQVLARQWKV → MVGVPGAAAFQL

    Note: No experimental confirmation available.

    Show »
    Length:595
    Mass (Da):65,878
    Checksum:i19D9363F626BEF0F
    GO

    Sequence cautioni

    The sequence AK307887 differs from that shown. Reason: Frameshift at position 438.
    The sequence AAC19378.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti31 – 311P → H in AAH15066. (PubMed:15489334)Curated
    Sequence conflicti266 – 2661A → V in AK307887. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2929Missing in isoform 2 and isoform 3. 2 PublicationsVSP_008121Add
    BLAST
    Alternative sequencei1 – 2121MAKES…RQWKV → MVGVPGAAAFQL in isoform 5. 1 PublicationVSP_047410Add
    BLAST
    Alternative sequencei1 – 2020MAKES…ARQWK → MGFHHVGQARLELLTSGDLP ALASQRAGIT in isoform 4. 1 PublicationVSP_008122Add
    BLAST
    Alternative sequencei240 – 29253RREEN…PPPLQ → SCIIHLKSMGVASRHEYFSG TLQMPAHPVRNSTLENLWVD CSRSLRSTVLPFP in isoform 3. 1 PublicationVSP_008123Add
    BLAST
    Alternative sequencei293 – 604312Missing in isoform 3. 1 PublicationVSP_008124Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF039200 mRNA. Translation: AAC17499.1.
    AF068266 mRNA. Translation: AAC19378.1. Different initiation.
    AF013970 mRNA. Translation: AAC39841.1.
    AF069747 mRNA. Translation: AAD02825.1.
    AF076461
    , AF076452, AF076453, AF076454, AF076455, AF076456, AF076457, AF076458, AF076459, AF076460 Genomic DNA. Translation: AAD41221.1.
    AK307887 mRNA. No translation available.
    AK314159 mRNA. Translation: BAG36843.1.
    AL034421, AL121906 Genomic DNA. Translation: CAI19280.2.
    AL034421, AL121906 Genomic DNA. Translation: CAI19281.1.
    AL121906, AL034421 Genomic DNA. Translation: CAI22125.1.
    AL121906, AL034421 Genomic DNA. Translation: CAI22130.1.
    AL121906, AL034421 Genomic DNA. Translation: CAM28282.1.
    AL162505 Genomic DNA. No translation available.
    CH471077 Genomic DNA. Translation: EAW76311.1.
    BC015066 mRNA. Translation: AAH15066.1.
    BC016298 mRNA. Translation: AAH16298.2.
    BC040344 mRNA. Translation: AAH40344.1.
    AF052210 mRNA. Translation: AAC64699.1.
    CCDSiCCDS13221.1. [O43439-1]
    CCDS46590.1. [O43439-5]
    RefSeqiNP_001028171.1. NM_001032999.2. [O43439-5]
    NP_001034798.1. NM_001039709.1. [O43439-2]
    NP_005084.1. NM_005093.3. [O43439-1]
    XP_006723949.1. XM_006723886.1. [O43439-1]
    UniGeneiHs.153934.

    Genome annotation databases

    EnsembliENST00000342704; ENSP00000345810; ENSG00000078699. [O43439-5]
    ENST00000344201; ENSP00000341865; ENSG00000078699. [O43439-3]
    ENST00000346541; ENSP00000262653; ENSG00000078699. [O43439-1]
    ENST00000359606; ENSP00000352622; ENSG00000078699. [O43439-4]
    ENST00000375279; ENSP00000364428; ENSG00000078699. [O43439-1]
    ENST00000397800; ENSP00000380902; ENSG00000078699. [O43439-2]
    ENST00000492345; ENSP00000433270; ENSG00000078699. [O43439-2]
    GeneIDi9139.
    KEGGihsa:9139.
    UCSCiuc002wzg.1. human. [O43439-1]
    uc021wbz.1. human. [O43439-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF039200 mRNA. Translation: AAC17499.1 .
    AF068266 mRNA. Translation: AAC19378.1 . Different initiation.
    AF013970 mRNA. Translation: AAC39841.1 .
    AF069747 mRNA. Translation: AAD02825.1 .
    AF076461
    , AF076452 , AF076453 , AF076454 , AF076455 , AF076456 , AF076457 , AF076458 , AF076459 , AF076460 Genomic DNA. Translation: AAD41221.1 .
    AK307887 mRNA. No translation available.
    AK314159 mRNA. Translation: BAG36843.1 .
    AL034421 , AL121906 Genomic DNA. Translation: CAI19280.2 .
    AL034421 , AL121906 Genomic DNA. Translation: CAI19281.1 .
    AL121906 , AL034421 Genomic DNA. Translation: CAI22125.1 .
    AL121906 , AL034421 Genomic DNA. Translation: CAI22130.1 .
    AL121906 , AL034421 Genomic DNA. Translation: CAM28282.1 .
    AL162505 Genomic DNA. No translation available.
    CH471077 Genomic DNA. Translation: EAW76311.1 .
    BC015066 mRNA. Translation: AAH15066.1 .
    BC016298 mRNA. Translation: AAH16298.2 .
    BC040344 mRNA. Translation: AAH40344.1 .
    AF052210 mRNA. Translation: AAC64699.1 .
    CCDSi CCDS13221.1. [O43439-1 ]
    CCDS46590.1. [O43439-5 ]
    RefSeqi NP_001028171.1. NM_001032999.2. [O43439-5 ]
    NP_001034798.1. NM_001039709.1. [O43439-2 ]
    NP_005084.1. NM_005093.3. [O43439-1 ]
    XP_006723949.1. XM_006723886.1. [O43439-1 ]
    UniGenei Hs.153934.

    3D structure databases

    ProteinModelPortali O43439.
    SMRi O43439. Positions 112-209, 336-392, 429-459, 497-543.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114586. 20 interactions.
    IntActi O43439. 9 interactions.
    MINTi MINT-2865952.

    PTM databases

    PhosphoSitei O43439.

    Proteomic databases

    MaxQBi O43439.
    PaxDbi O43439.
    PRIDEi O43439.

    Protocols and materials databases

    DNASUi 9139.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000342704 ; ENSP00000345810 ; ENSG00000078699 . [O43439-5 ]
    ENST00000344201 ; ENSP00000341865 ; ENSG00000078699 . [O43439-3 ]
    ENST00000346541 ; ENSP00000262653 ; ENSG00000078699 . [O43439-1 ]
    ENST00000359606 ; ENSP00000352622 ; ENSG00000078699 . [O43439-4 ]
    ENST00000375279 ; ENSP00000364428 ; ENSG00000078699 . [O43439-1 ]
    ENST00000397800 ; ENSP00000380902 ; ENSG00000078699 . [O43439-2 ]
    ENST00000492345 ; ENSP00000433270 ; ENSG00000078699 . [O43439-2 ]
    GeneIDi 9139.
    KEGGi hsa:9139.
    UCSCi uc002wzg.1. human. [O43439-1 ]
    uc021wbz.1. human. [O43439-3 ]

    Organism-specific databases

    CTDi 9139.
    GeneCardsi GC20P032077.
    HGNCi HGNC:1536. CBFA2T2.
    HPAi HPA060523.
    MIMi 603672. gene.
    neXtProti NX_O43439.
    PharmGKBi PA26112.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG79810.
    HOVERGENi HBG000169.
    OMAi SEYRGTE.
    OrthoDBi EOG70W3D2.
    PhylomeDBi O43439.
    TreeFami TF106303.

    Miscellaneous databases

    ChiTaRSi CBFA2T2. human.
    GeneWikii CBFA2T2.
    GenomeRNAii 9139.
    NextBioi 34271.
    PROi O43439.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O43439.
    Bgeei O43439.
    Genevestigatori O43439.

    Family and domain databases

    InterProi IPR013289. ETO.
    IPR013291. MTGR1.
    IPR014896. NHR2.
    IPR003894. TAFH_NHR1.
    IPR002893. Znf_MYND.
    [Graphical view ]
    Pfami PF08788. NHR2. 1 hit.
    PF07531. TAFH. 1 hit.
    PF01753. zf-MYND. 1 hit.
    [Graphical view ]
    PRINTSi PR01875. ETOFAMILY.
    PR01877. MTGR1PROTEIN.
    SMARTi SM00549. TAFH. 1 hit.
    [Graphical view ]
    PROSITEi PS51119. TAFH. 1 hit.
    PS01360. ZF_MYND_1. 1 hit.
    PS50865. ZF_MYND_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "EHT, a new member of the MTG8/ETO gene family, maps on 20q11 region and is deleted in acute myeloid leukemias."
      Fracchiolla N.S., Colombo G., Finelli P., Maiolo A.T., Neri A.
      Blood 92:3481-3484(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    2. "The AML1-MTG8 leukemic fusion protein forms a complex with a novel member of the MTG8(ETO/CDR) family, MTGR1."
      Kitabayashi I., Ida K., Morohoshi F., Yokoyama A., Mitsuhashi N., Shimizu K., Nomura N., Hayashi Y., Ohki M.
      Mol. Cell. Biol. 18:846-858(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, PHOSPHORYLATION, INTERACTION WITH MTG8 AND AML1-MTG8.
      Tissue: Leukemia.
    3. "Structure and expression pattern of a human MTG8/ETO family gene, MTGR1."
      Morohoshi F., Mitani S., Mitsuhashi N., Kitabayashi I., Takahashi E., Suzuki M., Munakata N., Ohki M.
      Gene 241:287-295(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 2), TISSUE SPECIFICITY.
      Tissue: Leukemia.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-532 (ISOFORM 5).
      Tissue: Brain and Hippocampus.
    5. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Tissue: Eye, Ovary and Prostate.
    8. "CBFA2T1, a gene rearranged in human leukemia, is a member of a multigene family."
      Calabi F., Cilli V.
      Genomics 52:332-341(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 22-604 (ISOFORMS 1/4/5), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
      Tissue: Fetal brain and Retina.
    9. "The transcriptional corepressor MTG16a contains a novel nucleolar targeting sequence deranged in t(16; 21)-positive myeloid malignancies."
      Hoogeveen A.T., Rossetti S., Stoyanova V., Schonkeren J., Fenaroli A., Schiaffonati L., van Unen L., Sacchi N.
      Oncogene 21:6703-6712(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CBFA2T3.
    10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-409, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiMTG8R_HUMAN
    AccessioniPrimary (citable) accession number: O43439
    Secondary accession number(s): B2RAE6
    , F8W6D7, Q5TGE4, Q5TGE5, Q5TGE6, Q5TGE7, Q8IWF3, Q96B06, Q96L00, Q9H436, Q9UJP8, Q9UJP9, Q9UP24
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 29, 2003
    Last sequence update: June 1, 1998
    Last modified: October 1, 2014
    This is version 126 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3