SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O43439

- MTG8R_HUMAN

UniProt

O43439 - MTG8R_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein CBFA2T2

Gene
CBFA2T2, EHT, MTGR1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May function as a complex with the chimeric protein RUNX1/AML1-CBFA2T1/MTG8 which is produced in acute myeloid leukemia with the chromosomal translocation t(8;21). May thus be involved in the repression of AML1-dependent transcription and the induction of G-CSF/CSF3-dependent cell growth. May be a tumor suppressor gene candidate involved in myeloid tumors with the deletion of the 20q11 region.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri517 – 55337MYND-typeAdd
BLAST

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. protein binding Source: IntAct
  3. sequence-specific DNA binding transcription factor activity Source: InterPro
  4. transcription corepressor activity Source: UniProtKB

GO - Biological processi

  1. epithelial cell differentiation Source: Ensembl
  2. negative regulation of neuron projection development Source: UniProtKB
  3. negative regulation of transcription, DNA-templated Source: Ensembl
  4. positive regulation of neuron projection development Source: UniProtKB
  5. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein CBFA2T2
Alternative name(s):
ETO homologous on chromosome 20
MTG8-like protein
MTG8-related protein 1
Myeloid translocation-related protein 1
p85
Gene namesi
Name:CBFA2T2
Synonyms:EHT, MTGR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 20

Organism-specific databases

HGNCiHGNC:1536. CBFA2T2.

Subcellular locationi

Nucleus Inferred

GO - Cellular componenti

  1. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26112.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 604604Protein CBFA2T2PRO_0000218301Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei409 – 4091Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO43439.
PaxDbiO43439.
PRIDEiO43439.

PTM databases

PhosphoSiteiO43439.

Expressioni

Tissue specificityi

Ubiquitously expressed in fetal and adult tissues. Highly expressed in adult brain, heart, lung, kidney, lymph node, appendix, thymus, testis, uterus, small intestine, prostate and thymus.4 Publications

Gene expression databases

ArrayExpressiO43439.
BgeeiO43439.
GenevestigatoriO43439.

Organism-specific databases

HPAiHPA060523.

Interactioni

Subunit structurei

Homooligomer and heterooligomer with MTG8. Forms a heterooligomer with the RUNX1/AML1-CBFA2T1/MTG8 chimeric protein, via an interaction with MTG8. Heterodimer with CBFA2T3.

Binary interactionsi

WithEntry#Exp.IntActNotes
MDFIQ997504EBI-748628,EBI-724076

Protein-protein interaction databases

BioGridi114586. 20 interactions.
IntActiO43439. 9 interactions.
MINTiMINT-2865952.

Structurei

3D structure databases

ProteinModelPortaliO43439.
SMRiO43439. Positions 112-209, 336-392, 429-459, 497-543.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini113 – 20896TAFHAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili451 – 49141 Reviewed predictionAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi33 – 9765Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the CBFA2T family.
Contains 1 TAFH (NHR1) domain.

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri517 – 55337MYND-typeAdd
BLAST

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiNOG79810.
HOVERGENiHBG000169.
OMAiSEYRGTE.
OrthoDBiEOG70W3D2.
PhylomeDBiO43439.
TreeFamiTF106303.

Family and domain databases

InterProiIPR013289. ETO.
IPR013291. MTGR1.
IPR014896. NHR2.
IPR003894. TAFH_NHR1.
IPR002893. Znf_MYND.
[Graphical view]
PfamiPF08788. NHR2. 1 hit.
PF07531. TAFH. 1 hit.
PF01753. zf-MYND. 1 hit.
[Graphical view]
PRINTSiPR01875. ETOFAMILY.
PR01877. MTGR1PROTEIN.
SMARTiSM00549. TAFH. 1 hit.
[Graphical view]
PROSITEiPS51119. TAFH. 1 hit.
PS01360. ZF_MYND_1. 1 hit.
PS50865. ZF_MYND_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O43439-1) [UniParc]FASTAAdd to Basket

Also known as: MTGR1b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAKESGISLK EIQVLARQWK VGPEKRVPAM PGSPVEVKIQ SRSSPPTMPP    50
LPPINPGGPR PVSFTPTALS NGINHSPPTL NGAPSPPQRF SNGPASSTSS 100
ALTNQQLPAT CGARQLSKLK RFLTTLQQFG NDISPEIGEK VRTLVLALVN 150
STVTIEEFHC KLQEATNFPL RPFVIPFLKA NLPLLQRELL HCARAAKQTP 200
SQYLAQHEHL LLNTSIASPA DSSELLMEVH GNGKRPSPER REENSFDRDT 250
IAPEPPAKRV CTISPAPRHS PALTVPLMNP GGQFHPTPPP LQHYTLEDIA 300
TSHLYREPNK MLEHREVRDR HHSLGLNGGY QDELVDHRLT EREWADEWKH 350
LDHALNCIME MVEKTRRSMA VLRRCQESDR EELNYWKRRY NENTELRKTG 400
TELVSRQHSP GSADSLSNDS QREFNSRPGT GYVPVEFWKK TEEAVNKVKI 450
QAMSEVQKAV AEAEQKAFEV IATERARMEQ TIADVKRQAA EDAFLVINEQ 500
EESTENCWNC GRKASETCSG CNIARYCGSF CQHKDWERHH RLCGQNLHGQ 550
SPHGQGRPLL PVGRGSSARS ADCSVPSPAL DKTSATTSRS STPASVTAID 600
TNGL 604
Length:604
Mass (Da):67,133
Last modified:June 1, 1998 - v1
Checksum:i1E55618844908169
GO
Isoform 2 (identifier: O43439-2) [UniParc]FASTAAdd to Basket

Also known as: MTGR1a, EHT

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: Missing.

Show »
Length:575
Mass (Da):63,901
Checksum:i7B11331102BD85DB
GO
Isoform 3 (identifier: O43439-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: Missing.
     240-292: RREENSFDRD...QFHPTPPPLQ → SCIIHLKSMG...SLRSTVLPFP
     293-604: Missing.

Show »
Length:263
Mass (Da):28,567
Checksum:i6DB58D27B5066D25
GO
Isoform 4 (identifier: O43439-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MAKESGISLKEIQVLARQWK → MGFHHVGQARLELLTSGDLPALASQRAGIT

Show »
Length:614
Mass (Da):67,965
Checksum:iF5373F002C17ACB4
GO
Isoform 5 (identifier: O43439-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MAKESGISLKEIQVLARQWKV → MVGVPGAAAFQL

Note: No experimental confirmation available.

Show »
Length:595
Mass (Da):65,878
Checksum:i19D9363F626BEF0F
GO

Sequence cautioni

The sequence AK307887 differs from that shown. Reason: Frameshift at position 438.
The sequence AAC19378.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2929Missing in isoform 2 and isoform 3. VSP_008121Add
BLAST
Alternative sequencei1 – 2121MAKES…RQWKV → MVGVPGAAAFQL in isoform 5. VSP_047410Add
BLAST
Alternative sequencei1 – 2020MAKES…ARQWK → MGFHHVGQARLELLTSGDLP ALASQRAGIT in isoform 4. VSP_008122Add
BLAST
Alternative sequencei240 – 29253RREEN…PPPLQ → SCIIHLKSMGVASRHEYFSG TLQMPAHPVRNSTLENLWVD CSRSLRSTVLPFP in isoform 3. VSP_008123Add
BLAST
Alternative sequencei293 – 604312Missing in isoform 3. VSP_008124Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti31 – 311P → H in AAH15066. 1 Publication
Sequence conflicti266 – 2661A → V in AK307887. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF039200 mRNA. Translation: AAC17499.1.
AF068266 mRNA. Translation: AAC19378.1. Different initiation.
AF013970 mRNA. Translation: AAC39841.1.
AF069747 mRNA. Translation: AAD02825.1.
AF076461
, AF076452, AF076453, AF076454, AF076455, AF076456, AF076457, AF076458, AF076459, AF076460 Genomic DNA. Translation: AAD41221.1.
AK307887 mRNA. No translation available.
AK314159 mRNA. Translation: BAG36843.1.
AL034421, AL121906 Genomic DNA. Translation: CAI19280.2.
AL034421, AL121906 Genomic DNA. Translation: CAI19281.1.
AL121906, AL034421 Genomic DNA. Translation: CAI22125.1.
AL121906, AL034421 Genomic DNA. Translation: CAI22130.1.
AL121906, AL034421 Genomic DNA. Translation: CAM28282.1.
AL162505 Genomic DNA. No translation available.
CH471077 Genomic DNA. Translation: EAW76311.1.
BC015066 mRNA. Translation: AAH15066.1.
BC016298 mRNA. Translation: AAH16298.2.
BC040344 mRNA. Translation: AAH40344.1.
AF052210 mRNA. Translation: AAC64699.1.
CCDSiCCDS13221.1. [O43439-1]
CCDS46590.1. [O43439-5]
RefSeqiNP_001028171.1. NM_001032999.2. [O43439-5]
NP_001034798.1. NM_001039709.1. [O43439-2]
NP_005084.1. NM_005093.3. [O43439-1]
XP_006723949.1. XM_006723886.1. [O43439-1]
UniGeneiHs.153934.

Genome annotation databases

EnsembliENST00000342704; ENSP00000345810; ENSG00000078699. [O43439-5]
ENST00000344201; ENSP00000341865; ENSG00000078699. [O43439-3]
ENST00000346541; ENSP00000262653; ENSG00000078699. [O43439-1]
ENST00000359606; ENSP00000352622; ENSG00000078699. [O43439-4]
ENST00000375279; ENSP00000364428; ENSG00000078699. [O43439-1]
ENST00000397798; ENSP00000380900; ENSG00000078699. [O43439-3]
ENST00000397800; ENSP00000380902; ENSG00000078699. [O43439-2]
ENST00000492345; ENSP00000433270; ENSG00000078699. [O43439-2]
GeneIDi9139.
KEGGihsa:9139.
UCSCiuc002wzg.1. human. [O43439-1]
uc021wbz.1. human. [O43439-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF039200 mRNA. Translation: AAC17499.1 .
AF068266 mRNA. Translation: AAC19378.1 . Different initiation.
AF013970 mRNA. Translation: AAC39841.1 .
AF069747 mRNA. Translation: AAD02825.1 .
AF076461
, AF076452 , AF076453 , AF076454 , AF076455 , AF076456 , AF076457 , AF076458 , AF076459 , AF076460 Genomic DNA. Translation: AAD41221.1 .
AK307887 mRNA. No translation available.
AK314159 mRNA. Translation: BAG36843.1 .
AL034421 , AL121906 Genomic DNA. Translation: CAI19280.2 .
AL034421 , AL121906 Genomic DNA. Translation: CAI19281.1 .
AL121906 , AL034421 Genomic DNA. Translation: CAI22125.1 .
AL121906 , AL034421 Genomic DNA. Translation: CAI22130.1 .
AL121906 , AL034421 Genomic DNA. Translation: CAM28282.1 .
AL162505 Genomic DNA. No translation available.
CH471077 Genomic DNA. Translation: EAW76311.1 .
BC015066 mRNA. Translation: AAH15066.1 .
BC016298 mRNA. Translation: AAH16298.2 .
BC040344 mRNA. Translation: AAH40344.1 .
AF052210 mRNA. Translation: AAC64699.1 .
CCDSi CCDS13221.1. [O43439-1 ]
CCDS46590.1. [O43439-5 ]
RefSeqi NP_001028171.1. NM_001032999.2. [O43439-5 ]
NP_001034798.1. NM_001039709.1. [O43439-2 ]
NP_005084.1. NM_005093.3. [O43439-1 ]
XP_006723949.1. XM_006723886.1. [O43439-1 ]
UniGenei Hs.153934.

3D structure databases

ProteinModelPortali O43439.
SMRi O43439. Positions 112-209, 336-392, 429-459, 497-543.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114586. 20 interactions.
IntActi O43439. 9 interactions.
MINTi MINT-2865952.

PTM databases

PhosphoSitei O43439.

Proteomic databases

MaxQBi O43439.
PaxDbi O43439.
PRIDEi O43439.

Protocols and materials databases

DNASUi 9139.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000342704 ; ENSP00000345810 ; ENSG00000078699 . [O43439-5 ]
ENST00000344201 ; ENSP00000341865 ; ENSG00000078699 . [O43439-3 ]
ENST00000346541 ; ENSP00000262653 ; ENSG00000078699 . [O43439-1 ]
ENST00000359606 ; ENSP00000352622 ; ENSG00000078699 . [O43439-4 ]
ENST00000375279 ; ENSP00000364428 ; ENSG00000078699 . [O43439-1 ]
ENST00000397798 ; ENSP00000380900 ; ENSG00000078699 . [O43439-3 ]
ENST00000397800 ; ENSP00000380902 ; ENSG00000078699 . [O43439-2 ]
ENST00000492345 ; ENSP00000433270 ; ENSG00000078699 . [O43439-2 ]
GeneIDi 9139.
KEGGi hsa:9139.
UCSCi uc002wzg.1. human. [O43439-1 ]
uc021wbz.1. human. [O43439-3 ]

Organism-specific databases

CTDi 9139.
GeneCardsi GC20P032077.
HGNCi HGNC:1536. CBFA2T2.
HPAi HPA060523.
MIMi 603672. gene.
neXtProti NX_O43439.
PharmGKBi PA26112.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG79810.
HOVERGENi HBG000169.
OMAi SEYRGTE.
OrthoDBi EOG70W3D2.
PhylomeDBi O43439.
TreeFami TF106303.

Miscellaneous databases

ChiTaRSi CBFA2T2. human.
GeneWikii CBFA2T2.
GenomeRNAii 9139.
NextBioi 34271.
PROi O43439.
SOURCEi Search...

Gene expression databases

ArrayExpressi O43439.
Bgeei O43439.
Genevestigatori O43439.

Family and domain databases

InterProi IPR013289. ETO.
IPR013291. MTGR1.
IPR014896. NHR2.
IPR003894. TAFH_NHR1.
IPR002893. Znf_MYND.
[Graphical view ]
Pfami PF08788. NHR2. 1 hit.
PF07531. TAFH. 1 hit.
PF01753. zf-MYND. 1 hit.
[Graphical view ]
PRINTSi PR01875. ETOFAMILY.
PR01877. MTGR1PROTEIN.
SMARTi SM00549. TAFH. 1 hit.
[Graphical view ]
PROSITEi PS51119. TAFH. 1 hit.
PS01360. ZF_MYND_1. 1 hit.
PS50865. ZF_MYND_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "EHT, a new member of the MTG8/ETO gene family, maps on 20q11 region and is deleted in acute myeloid leukemias."
    Fracchiolla N.S., Colombo G., Finelli P., Maiolo A.T., Neri A.
    Blood 92:3481-3484(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
  2. "The AML1-MTG8 leukemic fusion protein forms a complex with a novel member of the MTG8(ETO/CDR) family, MTGR1."
    Kitabayashi I., Ida K., Morohoshi F., Yokoyama A., Mitsuhashi N., Shimizu K., Nomura N., Hayashi Y., Ohki M.
    Mol. Cell. Biol. 18:846-858(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, PHOSPHORYLATION, INTERACTION WITH MTG8 AND AML1-MTG8.
    Tissue: Leukemia.
  3. "Structure and expression pattern of a human MTG8/ETO family gene, MTGR1."
    Morohoshi F., Mitani S., Mitsuhashi N., Kitabayashi I., Takahashi E., Suzuki M., Munakata N., Ohki M.
    Gene 241:287-295(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 2), TISSUE SPECIFICITY.
    Tissue: Leukemia.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-532 (ISOFORM 5).
    Tissue: Brain and Hippocampus.
  5. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Eye, Ovary and Prostate.
  8. "CBFA2T1, a gene rearranged in human leukemia, is a member of a multigene family."
    Calabi F., Cilli V.
    Genomics 52:332-341(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 22-604 (ISOFORMS 1/4/5), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    Tissue: Fetal brain and Retina.
  9. "The transcriptional corepressor MTG16a contains a novel nucleolar targeting sequence deranged in t(16; 21)-positive myeloid malignancies."
    Hoogeveen A.T., Rossetti S., Stoyanova V., Schonkeren J., Fenaroli A., Schiaffonati L., van Unen L., Sacchi N.
    Oncogene 21:6703-6712(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CBFA2T3.
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-409, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiMTG8R_HUMAN
AccessioniPrimary (citable) accession number: O43439
Secondary accession number(s): B2RAE6
, F8W6D7, Q5TGE4, Q5TGE5, Q5TGE6, Q5TGE7, Q8IWF3, Q96B06, Q96L00, Q9H436, Q9UJP8, Q9UJP9, Q9UP24
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: June 1, 1998
Last modified: July 9, 2014
This is version 125 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi