Reviewed,
UniProtKB/Swiss-Prot O43426 (SYNJ1_HUMAN)
Last modified
November 25, 2008.
Version 86.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Synaptojanin-1 EC=3.1.3.36 Alternative name(s): Synaptic inositol-1,4,5-trisphosphate 5-phosphatase 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1573 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Inositol 5-phosphatase which has a role in clathrin-mediated endocytosis. |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 4-phosphate + phosphate. |
| Subunit structure | Binds AMPH, SH3GL1, SH3GL2 and SH3GL3. |
| Subcellular location | CytoplasmBy similarity. |
| Tissue specificity | Concentrated at clathrin-coated endocytic intermediates in nerve terminals. Isoform 1 is more enriched than isoform 2 in developing brain as well as non-neuronal cells. Isoform 2 is very abundant in nerve terminals. |
| Domain | Binds to EPS15 (a clathrin coat-associated protein) via a C-terminal domain containing three Asn-Pro-Phe (NPF) repeats By similarity. The C-terminal proline-rich region mediates binding to a variety of SH3 domain-containing proteins including AMPH, SH3GL1, SH3GL2, SH3GL3 and GRB2. |
| Sequence similarities | Belongs to the synaptojanin family. In the central section; belongs to the inositol-1,4,5-trisphosphate 5-phosphatase family. Contains 1 RRM (RNA recognition motif) domain. Contains 1 SAC domain. |
Ontologies
Keywords | |
|---|---|
| Biological process | Endocytosis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Ligand | RNA-binding |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
Gene Ontology (GO) | |
| Biological process | phosphate metabolic process Ref.1 Traceable author statement. Source: ProtInc synaptic vesicle endocytosis Ref.1Traceable author statement. Source: ProtInc |
| Molecular function | RNA binding Inferred from electronic annotation. Source: UniProtKB-KW inositol-polyphosphate 5-phosphatase activity Ref.1Traceable author statement. Source: ProtInc phosphatidylinositol-4,5-bisphosphate 5-phosphatase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43426-1) Also known as: Synaptojanin-170; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43426-2) Also known as: Synaptojanin-145; The sequence of this isoform differs from the canonical sequence as follows: 1306-1311: VKTNGI → QEQPSG 1312-1573: Missing. | ||||||
| Isoform 3 (identifier: O43426-4) The sequence of this isoform differs from the canonical sequence as follows: 1094-1159: LPQKDPAQPL...SPGVARREME → PPRPVAPPTRPAPPQRPPPPSGARSPAPTRKEFG 1306-1311: VKTNGI → QEQPSG 1312-1573: Missing. | ||||||
| Isoform 4 (identifier: O43426-5) The sequence of this isoform differs from the canonical sequence as follows: 451-451: K → KAGK 504-511: Missing. 525-1573: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||
Molecule processing | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1573 | 1573 | Synaptojanin-1 | PRO_0000209730 | |||||||||||||||||||
Regions | |||||||||||||||||||||||
| Domain | 119 – 442 | 324 | SAC | ||||||||||||||||||||
| Domain | 902 – 971 | 70 | RRM | ||||||||||||||||||||
| Repeat | 1396 – 1398 | 3 | 1 | ||||||||||||||||||||
| Repeat | 1406 – 1408 | 3 | 2 | ||||||||||||||||||||
| Repeat | 1417 – 1419 | 3 | 3 | ||||||||||||||||||||
| Region | 500 – 899 | 400 | Catalytic Potential | ||||||||||||||||||||
| Region | 1396 – 1419 | 24 | 3 X 3 AA repeats of N-P-F | ||||||||||||||||||||
| Compositional bias | 900 – 1573 | 674 | Pro-rich | ||||||||||||||||||||
| Compositional bias | 1033 – 1036 | 4 | Poly-Ser | ||||||||||||||||||||
| Compositional bias | 1108 – 1113 | 6 | Poly-Pro | ||||||||||||||||||||
| Compositional bias | 1126 – 1129 | 4 | Poly-Pro | ||||||||||||||||||||
| Compositional bias | 1485 – 1488 | 4 | Poly-Glu | ||||||||||||||||||||
| Compositional bias | 1538 – 1544 | 7 | Poly-Pro | ||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||
| Modified residue | 784 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||
| Modified residue | 786 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||
| Modified residue | 1048 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||
| Modified residue | 1053 | 1 | Phosphoserine By similarity | ||||||||||||||||||||
| Modified residue | 1084 | 1 | Phosphoserine By similarity | ||||||||||||||||||||
| Modified residue | 1150 | 1 | Phosphoserine By similarity | ||||||||||||||||||||
| Modified residue | 1345 | 1 | Phosphoserine By similarity | ||||||||||||||||||||
| Modified residue | 1349 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||
Natural variations | |||||||||||||||||||||||
| Alternative sequence | 451 | 1 | K → KAGK in isoform 4. | VSP_035709 | |||||||||||||||||||
| Alternative sequence | 504 – 511 | 8 | Missing in isoform 4. | VSP_035710 | |||||||||||||||||||
| Alternative sequence | 525 – 1573 | 1049 | Missing in isoform 4. | VSP_035711 | |||||||||||||||||||
| Alternative sequence | 1094 – 1159 | 66 | LPQKD…RREME → PPRPVAPPTRPAPPQRPPPP SGARSPAPTRKEFG in isoform 3. | VSP_016104 | |||||||||||||||||||
| Alternative sequence | 1306 – 1311 | 6 | VKTNGI → QEQPSG in isoform 2 and isoform 3. | VSP_002682 | |||||||||||||||||||
| Alternative sequence | 1312 – 1573 | 262 | Missing in isoform 2 and isoform 3. | VSP_002683 | |||||||||||||||||||
| Natural variant | 295 | 1 | K → R: dbSNP rs2254562. | VAR_047308 | |||||||||||||||||||
| Natural variant | 1366 | 1 | V → A: dbSNP rs9980589. | VAR_047309 | |||||||||||||||||||
| Natural variant | 1545 | 1 | L → P: dbSNP rs2230767. | VAR_047310 | |||||||||||||||||||
Experimental info | |||||||||||||||||||||||
| Sequence conflict | 1366 | 1 | V → VNT in AAC51922. Ref.1 | ||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||
| Beta strand | 895 – 901 | 7 | |||||||||||||||||||||
| Turn | 905 – 907 | 3 | |||||||||||||||||||||
| Helix | 912 – 923 | 12 | |||||||||||||||||||||
| Beta strand | 928 – 933 | 6 | |||||||||||||||||||||
| Beta strand | 935 – 944 | 10 | |||||||||||||||||||||
| Helix | 945 – 950 | 6 | |||||||||||||||||||||
| Helix | 951 – 954 | 4 | |||||||||||||||||||||
| Beta strand | 962 – 968 | 7 | |||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Synaptojanin 1: localization on coated endocytic intermediates in nerve terminals and interaction of its 170 kDa isoform with Eps15." Haffner C., Takei K., Chen H., Ringstad N., Hudson A., Butler M.H., Salcini A.E., Di Fiore P.P., De Camilli P. FEBS Lett. 419:175-180(1997) [PubMed: 9428629] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT ARG-295. Tissue: Cerebellum. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed: 10048485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [3] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed: 12168954] [Abstract] Cited for: SEQUENCE REVISION. |
| [4] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed: 10830953] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Placenta. |
| [6] | "The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity." Cestra G., Castagnoli L., Dente L., Minenkova O., Petrelli A., Migone N., Hoffmueller U., Schneider-Mergener J., Cesareni G. J. Biol. Chem. 274:32001-32007(1999) [PubMed: 10542231] [Abstract] Cited for: INTERACTION WITH AMPH; SH3GL1; SH3GL2 AND SH3GL3. |
| [7] | "Solution structure of RNA binding domain in synaptojanin 1." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 894-971. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF009039 mRNA. Translation: AAC51921.1. AF009040 mRNA. Translation: AAC51922.1. AB020717 mRNA. Translation: BAA74933.2. Different initiation. AP000275 Genomic DNA. No translation available. AP000276 Genomic DNA. No translation available. AP000277 Genomic DNA. No translation available. AP000278 Genomic DNA. No translation available. AP000279 Genomic DNA. No translation available. BC098395 mRNA. Translation: AAH98395.1. | |||||||||||||||||||||||||||||||
| RefSeq | NP_003886.2. NP_982271.1. | ||||||||||||||||||||||||||||||
| UniGene | Hs.473632 | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | O43426. | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENSG00000159082. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||
| GeneID | 8867. | ||||||||||||||||||||||||||||||
| KEGG | hsa:8867. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||

Clusters with