O43316 (PAX4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Paired box protein Pax-4 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 350 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays an important role in the differentiation and development of pancreatic islet beta cells. Transcriptional repressor that binds to a common element in the glucagon, insulin and somatostatin promoters. Competes with PAX6 for this same promoter binding site. Isoform 2 appears to be a dominant negative form antagonizing PAX4 transcriptional activity. |
| Subcellular location | |
| Involvement in disease | Diabetes mellitus, non-insulin-dependent (NIDDM) [MIM:125853]: A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Diabetes mellitus, insulin-dependent (IDDM) [MIM:222100]: A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Diabetes mellitus, ketosis-prone (KPD) [MIM:612227]: An atypical form of diabetes mellitus characterized by an acute initial presentation with severe hyperglycemia and ketosis, as seen in classic type 1 diabetes, but after initiation of insulin therapy, prolonged remission is often possible with cessation of insulin therapy and maintenance of appropriate metabolic control. Metabolic studies show a markedly blunted insulin secretory response to glucose, partially reversible with the improvement of blood glucose control. Variable levels of insulin resistance are observed, especially in obese patients. Pancreatic beta-cell autoimmunity is a rare finding. Maturity-onset diabetes of the young 9 (MODY9) [MIM:612225]: A form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. |
| Sequence similarities | Belongs to the paired homeobox family. Contains 1 homeobox DNA-binding domain. Contains 1 paired domain. |
| Sequence caution | The sequence AC073934 differs from that shown. Reason: According to the human genome assembly there is a stop codon in position 349. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43316-1) Also known as: Pax4; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43316-2) Also known as: Pax4V; The sequence of this isoform differs from the canonical sequence as follows: 239-257: Missing. 258-350: QSPGSVPTAA...ATPTHFSHWP → AVPWQCAHSSPACPGTTGSLLLSAVLGNSTRKVSE | ||||||
| Isoform 3 (identifier: O43316-4) The sequence of this isoform differs from the canonical sequence as follows: 1-8: Missing. 305-350: DCGSFLLPVI...ATPTHFSHWP → GHLPPQPNSL...PGCPLLYGLE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 350 | 350 | Paired box protein Pax-4 | PRO_0000050180 | |||||
Regions | |||||||||
| Domain | 5 – 131 | 127 | Paired | ||||||
| DNA binding | 170 – 229 | 60 | Homeobox | ||||||
| Region | 278 – 350 | 73 | Transcription repression | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 8 | 8 | Missing in isoform 3. | VSP_036448 | |||||
| Alternative sequence | 239 – 257 | 19 | Missing in isoform 2. | VSP_002359 | |||||
| Alternative sequence | 258 – 350 | 93 | QSPGS…FSHWP → AVPWQCAHSSPACPGTTGSL LLSAVLGNSTRKVSE in isoform 2. | VSP_002360 | |||||
| Alternative sequence | 305 – 350 | 46 | DCGSF…FSHWP → GHLPPQPNSLDSGLLCLPCP SSHCHLASLSGSQALLWPGC PLLYGLE in isoform 3. | VSP_036449 | |||||
| Natural variant | 39 | 1 | R → Q. Ref.9 | VAR_054879 | |||||
| Natural variant | 45 | 1 | R → W Associated with PKD susceptbility. Ref.7 | VAR_054880 | |||||
| Natural variant | 129 | 1 | R → W in diabetes mellitus type 2. Ref.6 | VAR_054881 | |||||
| Natural variant | 141 | 1 | R → W Confers susceptibility to ketosis-prone diabetes mellitus. Ref.7 | VAR_054882 | |||||
| Natural variant | 172 | 1 | R → W in MODY9; the mutant sequence represses the activity of the insulin and glucagon promoters by only 35% compared to 50% and 57% respectively with wild-type sequence. Ref.9 | VAR_054883 | |||||
| Natural variant | 191 | 1 | R → C. Ref.9 | VAR_054884 | |||||
| Natural variant | 200 | 1 | R → H. Ref.9 | VAR_054885 | |||||
| Natural variant | 200 | 1 | R → S. Ref.9 | VAR_054886 | |||||
| Isoform 3: | |||||||||
| Natural variant | 321 | 1 | H → P Associated with susceptibility to IDDM. Corresponds to variant rs712701 [ dbSNP | Ensembl ]. | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of mouse paired-box-containing gene (Pax-4) from an islet beta cell line and deduced sequence of human Pax-4." Matsushita T., Yamaoka T., Otsuka S., Moritani M., Matsumoto T., Itakura M. Biochem. Biophys. Res. Commun. 242:176-180(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Isolation and characterization of the human PAX4 gene." Tao T., Wasson J., Bernal-Mizrachi E., Behn P.S., Chayen S., Duprat L., Meyer J., Glaser B., Permutt M.A. Diabetes 47:1650-1653(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Placenta. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Colon. |
| [5] | "Expression of dominant negative form of PAX4 in human insulinoma." Miyamoto T., Kakizawa T., Ichikawa K., Nishio S., Kajikawa S., Hashizume K. Biochem. Biophys. Res. Commun. 282:34-40(2001) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 2). Tissue: Insulinoma. |
| [6] | "A missense mutation of Pax4 gene (R121W) is associated with type 2 diabetes in Japanese." Shimajiri Y., Sanke T., Furuta H., Hanabusa T., Nakagawa T., Fujitani Y., Kajimoto Y., Takasu N., Nanjo K. Diabetes 50:2864-2869(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DIABETES MELLITUS TYPE 2 TRP-129. |
| [7] | "PAX4 gene variations predispose to ketosis-prone diabetes." Mauvais-Jarvis F., Smith S.B., Le May C., Leal S.M., Gautier J.-F., Molokhia M., Riveline J.-P., Rajan A.S., Kevorkian J.-P., Zhang S., Vexiau P., German M.S., Vaisse C. Hum. Mol. Genet. 13:3151-3159(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS TRP-45 AND TRP-141, ASSOCIATION WITH SUSCEPTIBILITY TO KETOSIS-PRONE DIABETES. |
| [8] | "Association of childhood type 1 diabetes mellitus with a variant of PAX4: possible link to beta cell regenerative capacity." Biason-Lauber A., Boehm B., Lang-Muritano M., Gauthier B.R., Brun T., Wollheim C.B., Schoenle E.J. Diabetologia 48:900-905(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PRO-321 (ISOFORM 3), ASSOCIATION WITH SUSCEPTIBILITY TO IDDM. |
| [9] | "PAX4 mutations in Thais with maturity onset diabetes of the young." Plengvidhya N., Kooptiwut S., Songtawee N., Doi A., Furuta H., Nishi M., Nanjo K., Tantibhedhyangkul W., Boonyasrisawat W., Yenchitsomanus P.-T., Doria A., Banchuin N. J. Clin. Endocrinol. Metab. 92:2821-2826(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT MODY9 TRP-172, VARIANTS GLN-39; CYS-191; HIS-200 AND SER-200, VARIANT PRO-321 (ISOFORM 3), CHARACTERIZATION OF VARIANT MODY9 TRP-172. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB008913 mRNA. Translation: BAA24506.1. AF043978 mRNA. Translation: AAD02289.1. AC073934 Genomic DNA. No translation available. BC074761 mRNA. Translation: AAH74761.1. |
| IPI | IPI00011955. IPI00218426. IPI00844339. |
| RefSeq | NP_006184.2. NM_006193.2. |
| UniGene | Hs.129706. |
3D structure databases | |
| ProteinModelPortal | O43316. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000339906. |
Proteomic databases | |
| PaxDb | O43316. |
| PRIDE | O43316. |
Protocols and materials databases | |
| DNASU | 5078. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338516; ENSP00000344297; ENSG00000106331. ENST00000341640; ENSP00000339906; ENSG00000106331. |
| GeneID | 5078. |
| KEGG | hsa:5078. |
| UCSC | uc003vmg.1. human. uc010lld.1. human. |
Organism-specific databases | |
| CTD | 5078. |
| GeneCards | GC07M127250. |
| H-InvDB | HIX0033508. |
| HGNC | HGNC:8618. PAX4. |
| HPA | HPA006806. HPA007182. |
| MIM | 125853. phenotype. 167413. gene. 222100. phenotype. 612225. phenotype. 612227. phenotype. |
| neXtProt | NX_O43316. |
| Orphanet | 552. MODY syndrome. |
| PharmGKB | PA32958. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG309473. |
| HOGENOM | HOG000230939. |
| HOVERGEN | HBG009115. |
| KO | K08032. |
Enzyme and pathway databases | |
| Reactome | REACT_111045. Developmental Biology. |
Gene expression databases | |
| ArrayExpress | O43316. |
| Bgee | O43316. |
| CleanEx | HS_PAX4. |
| Genevestigator | O43316. |
Family and domain databases | |
| Gene3D | 1.10.10.10. 2 hits. 1.10.10.60. 1 hit. |
| InterPro | IPR017970. Homeobox_CS. IPR001356. Homeodomain. IPR009057. Homeodomain-like. IPR001523. Paired_dom. IPR011991. WHTH_DNA-bd_dom. [Graphical view] |
| Pfam | PF00046. Homeobox. 1 hit. PF00292. PAX. 1 hit. [Graphical view] |
| PRINTS | PR00027. PAIREDBOX. |
| SMART | SM00389. HOX. 1 hit. SM00351. PAX. 1 hit. [Graphical view] |
| SUPFAM | SSF46689. Homeodomain_like. 2 hits. |
| PROSITE | PS00027. HOMEOBOX_1. 1 hit. PS50071. HOMEOBOX_2. 1 hit. PS00034. PAIRED_1. 1 hit. PS51057. PAIRED_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 5078. |
| NextBio | 19588. |
| SOURCE | Search... |
Entry information
| Entry name | PAX4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43316 Secondary accession number(s): O95161, Q6B0H0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
