Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O43303

- CP110_HUMAN

UniProt

O43303 - CP110_HUMAN

Protein

Centriolar coiled-coil protein of 110 kDa

Gene

CCP110

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 121 (01 Oct 2014)
      Sequence version 3 (23 Oct 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Necessary for centrosome duplication at different stages of procentriole formation. Acts as a key negative regulator of ciliogenesis in collaboration with CEP97 by capping the mother centriole thereby preventing cilia formation. Required for correct spindle formation and has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CETN2.5 Publications

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. cell projection organization Source: UniProtKB-KW
    2. centriole replication Source: UniProtKB
    3. centrosome duplication Source: UniProtKB
    4. G2/M transition of mitotic cell cycle Source: Reactome
    5. mitotic cell cycle Source: Reactome
    6. regulation of cytokinesis Source: UniProtKB

    Keywords - Biological processi

    Cilium biogenesis/degradation

    Enzyme and pathway databases

    ReactomeiREACT_15296. Recruitment of mitotic centrosome proteins and complexes.
    REACT_15364. Loss of Nlp from mitotic centrosomes.
    REACT_15451. Loss of proteins required for interphase microtubule organization from the centrosome.
    REACT_160315. Regulation of PLK1 Activity at G2/M Transition.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Centriolar coiled-coil protein of 110 kDa
    Alternative name(s):
    Centrosomal protein of 110 kDa
    Short name:
    CP110
    Short name:
    Cep110
    Gene namesi
    Name:CCP110
    Synonyms:CEP110, CP110, KIAA0419
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:24342. CCP110.

    Subcellular locationi

    Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole 7 Publications
    Note: Recruited early and then associates with the growing distal tips. Recruited to the mother centriole by KIF24. Removed from centrioles by TTBK2, leading to initiation of ciliogenesis.

    GO - Cellular componenti

    1. centriole Source: UniProtKB
    2. centrosome Source: UniProtKB
    3. cytosol Source: Reactome
    4. protein complex Source: MGI

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi586 – 5883RRL → ARA: Abolishes interaction with CCNF. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10121012Centriolar coiled-coil protein of 110 kDaPRO_0000089460Add
    BLAST

    Post-translational modificationi

    Phosphorylated by CDKs.1 Publication
    Ubiquitinated by the SCF(CCNF) during G2 phase, leading to its degradation by the proteasome and preventing centrosome reduplication. Deubiquitinated by USP33 in S and G2/M phase, leading to stabilize CCP110 during the period which centrioles duplicate and elongate.2 Publications

    Keywords - PTMi

    Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiO43303.
    PaxDbiO43303.
    PRIDEiO43303.

    PTM databases

    PhosphoSiteiO43303.

    Expressioni

    Tissue specificityi

    Highly expressed in testis. Detected at intermediate levels in spleen, thymus, prostate, small intestine, colon and peripheral blood leukocytes.1 Publication

    Inductioni

    Up-regulated during the transition from G1 to S phase of the cell cycle. The highest levels are observed in S phase, after which the levels decrease markedly.1 Publication

    Gene expression databases

    ArrayExpressiO43303.
    BgeeiO43303.
    CleanExiHS_CEP110.
    GenevestigatoriO43303.

    Organism-specific databases

    HPAiHPA039402.

    Interactioni

    Subunit structurei

    Interacts with CALM1, CETN2, CEP76 and CEP97. Interacts with NEURL4 and CCNF; these interactions are not mutually exclusive and both lead to CCP110 ubiquitination and proteasome-dependent degradation. Via its interaction with NEURL4, may indirectly interact with HERC2. Interacts with KIF24, leading to its recruitment to centrioles. Interacts with USP20 and USP33.8 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CALM3P621589EBI-1566217,EBI-397435
    CCNFP410023EBI-1566217,EBI-1207574
    CEP97Q8IW3518EBI-1566217,EBI-1566210
    CETN2P412083EBI-1566217,EBI-1789926
    KIF24Q5T7B89EBI-1566217,EBI-2556811
    NEURL4Q96JN89EBI-1566217,EBI-1053406

    Protein-protein interaction databases

    BioGridi115087. 28 interactions.
    DIPiDIP-39892N.
    IntActiO43303. 19 interactions.
    MINTiMINT-7994609.

    Structurei

    3D structure databases

    ProteinModelPortaliO43303.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 223223CEP97 bindingAdd
    BLAST
    Regioni64 – 8219Calmodulin-bindingAdd
    BLAST
    Regioni350 – 565216Interaction with CEP76Add
    BLAST
    Regioni781 – 82141Calmodulin-bindingAdd
    BLAST
    Regioni909 – 92416Calmodulin-bindingAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili49 – 9042Sequence AnalysisAdd
    BLAST
    Coiled coili640 – 70970Sequence AnalysisAdd
    BLAST

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG82086.
    HOVERGENiHBG050873.
    InParanoidiO43303.
    KOiK16453.
    OMAiFYLWGSS.
    OrthoDBiEOG7SV0XP.
    PhylomeDBiO43303.
    TreeFamiTF332788.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O43303-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEEYEKFCEK SLARIQEASL STESFLPAQS ESISLIRFHG VAILSPLLNI     50
    EKRKEMQQEK QKALDVEARK QVNRKKALLT RVQEILDNVQ VRKAPNASDF 100
    DQWEMETVYS NSEVRNLNVP ATFPNSFPSH TEHSTAAKLD KIAGILPLDN 150
    EDQCKTDGID LARDSEGFNS PKQCDSSNIS HVENEAFPKT SSATPQETLI 200
    SDGPFSVNEQ QDLPLLAEVI PDPYVMSLQN LMKKSKEYIE REQSRRSLRG 250
    SINRIVNESH LDKEHDAVEV ADCVKEKGQL TGKHCVSVIP DKPSLNKSNV 300
    LLQGASTQAS SMSMPVLASF SKVDIPIRTG HPTVLESNSD FKVIPTFVTE 350
    NNVIKSLTGS YAKLPSPEPS MSPKMHRRRS RTSSACHILI NNPINACELS 400
    PKGKEQAMDL IIQDTDENTN VPEIMPKLPT DLAGVCSSKV YVGKNTSEVK 450
    EDVVLGKSNQ VCQSSGNHLE NKVTHGLVTV EGQLTSDERG AHIMNSTCAA 500
    MPKLHEPYAS SQCIASPNFG TVSGLKPASM LEKNCSLQTE LNKSYDVKNP 550
    SPLLMQNQNT RQQMDTPMVS CGNEQFLDNS FEKVKRRLDL DIDGLQKENC 600
    PYVITSGITE QERQHLPEKR YPKGSGFVNK NKMLGTSSKE SEELLKSKML 650
    AFEEMRKRLE EQHAQQLSLL IAEQEREQER LQKEIEEQEK MLKEKKAMTA 700
    EASELDINNA VELEWRKISD SSLLETMLSQ ADSLHTSNSN SSGFTNSAMQ 750
    YSFVSANEAP FYLWGSSTSG LTKLSVTRPF GRAKTRWSQV FSLEIQAKFN 800
    KITAVAKGFL TRRLMQTDKL KQLRQTVKDT MEFIRSFQSE APLKRGIVSA 850
    QDASLQERVL AQLRAALYGI HDIFFVMDAA ERMSILHHDR EVRKEKMLRQ 900
    MDKMKSPRVA LSAATQKSLD RKKYMKAAEM GMPNKKFLVK QNPSETRVLQ 950
    PNQGQNAPVH RLLSRQGTPK TSVKGVVQNR QKPSQSRVPN RVPVSGVYAG 1000
    KIQRKRPNVA TI 1012
    Length:1,012
    Mass (Da):113,424
    Last modified:October 23, 2007 - v3
    Checksum:i5459F655CFB9DFD0
    GO
    Isoform 2 (identifier: O43303-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         968-1012: TPKTSVKGVVQNRQKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI → SICRKNPKKAAKCCDNLRRQHSLG

    Show »
    Length:991
    Mass (Da):111,224
    Checksum:iCDEA157BFDBC92EA
    GO

    Sequence cautioni

    The sequence BAA24849.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti628 – 6281V → F in AAH36654. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti69 – 691R → S.
    Corresponds to variant rs16972129 [ dbSNP | Ensembl ].
    VAR_056788
    Natural varianti171 – 1711P → L.
    Corresponds to variant rs3751821 [ dbSNP | Ensembl ].
    VAR_056789
    Natural varianti252 – 2521I → M.4 Publications
    Corresponds to variant rs226891 [ dbSNP | Ensembl ].
    VAR_019823
    Natural varianti347 – 3471F → I.1 Publication
    Corresponds to variant rs11645625 [ dbSNP | Ensembl ].
    VAR_056790
    Natural varianti375 – 3751M → I.
    Corresponds to variant rs7190666 [ dbSNP | Ensembl ].
    VAR_019824

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei968 – 101245TPKTS…NVATI → SICRKNPKKAAKCCDNLRRQ HSLG in isoform 2. 2 PublicationsVSP_011897Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB007879 mRNA. Translation: BAA24849.2. Different initiation.
    CR749255 mRNA. Translation: CAH18111.1.
    AC003108 Genomic DNA. Translation: AAC05804.1.
    AC012621 Genomic DNA. No translation available.
    BC036654 mRNA. Translation: AAH36654.1.
    CCDSiCCDS10579.1. [O43303-2]
    CCDS55992.1. [O43303-1]
    PIRiT01372.
    RefSeqiNP_001185951.1. NM_001199022.1.
    NP_055526.3. NM_014711.4.
    XP_005255776.1. XM_005255719.1. [O43303-1]
    XP_005255778.1. XM_005255721.1. [O43303-2]
    UniGeneiHs.279912.

    Genome annotation databases

    EnsembliENST00000381396; ENSP00000370803; ENSG00000103540. [O43303-1]
    ENST00000396208; ENSP00000379511; ENSG00000103540. [O43303-2]
    ENST00000396212; ENSP00000379515; ENSG00000103540. [O43303-2]
    GeneIDi9738.
    KEGGihsa:9738.
    UCSCiuc002dgk.4. human. [O43303-2]
    uc002dgl.4. human. [O43303-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB007879 mRNA. Translation: BAA24849.2 . Different initiation.
    CR749255 mRNA. Translation: CAH18111.1 .
    AC003108 Genomic DNA. Translation: AAC05804.1 .
    AC012621 Genomic DNA. No translation available.
    BC036654 mRNA. Translation: AAH36654.1 .
    CCDSi CCDS10579.1. [O43303-2 ]
    CCDS55992.1. [O43303-1 ]
    PIRi T01372.
    RefSeqi NP_001185951.1. NM_001199022.1.
    NP_055526.3. NM_014711.4.
    XP_005255776.1. XM_005255719.1. [O43303-1 ]
    XP_005255778.1. XM_005255721.1. [O43303-2 ]
    UniGenei Hs.279912.

    3D structure databases

    ProteinModelPortali O43303.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115087. 28 interactions.
    DIPi DIP-39892N.
    IntActi O43303. 19 interactions.
    MINTi MINT-7994609.

    PTM databases

    PhosphoSitei O43303.

    Proteomic databases

    MaxQBi O43303.
    PaxDbi O43303.
    PRIDEi O43303.

    Protocols and materials databases

    DNASUi 9738.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000381396 ; ENSP00000370803 ; ENSG00000103540 . [O43303-1 ]
    ENST00000396208 ; ENSP00000379511 ; ENSG00000103540 . [O43303-2 ]
    ENST00000396212 ; ENSP00000379515 ; ENSG00000103540 . [O43303-2 ]
    GeneIDi 9738.
    KEGGi hsa:9738.
    UCSCi uc002dgk.4. human. [O43303-2 ]
    uc002dgl.4. human. [O43303-1 ]

    Organism-specific databases

    CTDi 9738.
    GeneCardsi GC16P019536.
    HGNCi HGNC:24342. CCP110.
    HPAi HPA039402.
    MIMi 609544. gene.
    neXtProti NX_O43303.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG82086.
    HOVERGENi HBG050873.
    InParanoidi O43303.
    KOi K16453.
    OMAi FYLWGSS.
    OrthoDBi EOG7SV0XP.
    PhylomeDBi O43303.
    TreeFami TF332788.

    Enzyme and pathway databases

    Reactomei REACT_15296. Recruitment of mitotic centrosome proteins and complexes.
    REACT_15364. Loss of Nlp from mitotic centrosomes.
    REACT_15451. Loss of proteins required for interphase microtubule organization from the centrosome.
    REACT_160315. Regulation of PLK1 Activity at G2/M Transition.

    Miscellaneous databases

    GeneWikii CCP110.
    GenomeRNAii 9738.
    NextBioi 36648.
    PROi O43303.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O43303.
    Bgeei O43303.
    CleanExi HS_CEP110.
    Genevestigatori O43303.

    Family and domain databases

    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro."
      Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 4:307-313(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS MET-252 AND ILE-347.
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-252.
      Tissue: Fetal kidney.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT MET-252.
    4. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT MET-252.
      Tissue: Testis.
    6. "CP110, a cell cycle-dependent CDK substrate, regulates centrosome duplication in human cells."
      Chen Z., Indjeian V.B., McManus M., Wang L., Dynlacht B.D.
      Dev. Cell 3:339-350(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION, PHOSPHORYLATION.
    7. "Proteomic characterization of the human centrosome by protein correlation profiling."
      Andersen J.S., Wilkinson C.J., Mayor T., Mortensen P., Nigg E.A., Mann M.
      Nature 426:570-574(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS].
      Tissue: Lymphoblast.
    8. "CP110 cooperates with two calcium-binding proteins to regulate cytokinesis and genome stability."
      Tsang W.Y., Spektor A., Luciano D.J., Indjeian V.B., Chen Z., Salisbury J.L., Sanchez I., Dynlacht B.D.
      Mol. Biol. Cell 17:3423-3434(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CALM1 AND CETN2, SUBCELLULAR LOCATION.
    9. "Cep97 and CP110 suppress a cilia assembly program."
      Spektor A., Tsang W.Y., Khoo D., Dynlacht B.D.
      Cell 130:678-690(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CALM1 AND CEP97, SUBCELLULAR LOCATION.
    10. Cited for: FUNCTION, SUBCELLULAR LOCATION.
    11. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. "Cep76, a centrosomal protein that specifically restrains centriole reduplication."
      Tsang W.Y., Spektor A., Vijayakumar S., Bista B.R., Li J., Sanchez I., Duensing S., Dynlacht B.D.
      Dev. Cell 16:649-660(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CEP76.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "SCF(Cyclin F) controls centrosome homeostasis and mitotic fidelity through CP110 degradation."
      D'Angiolella V., Donato V., Vijayakumar S., Saraf A., Florens L., Washburn M.P., Dynlacht B., Pagano M.
      Nature 466:138-142(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: UBIQUITINATION, SUBCELLULAR LOCATION, MUTAGENESIS OF 586-ARG--LEU-588, INTERACTION WITH CCNF.
    15. "Centriolar kinesin Kif24 interacts with CP110 to remodel microtubules and regulate ciliogenesis."
      Kobayashi T., Tsang W.Y., Li J., Lane W., Dynlacht B.D.
      Cell 145:914-925(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, INTERACTION WITH KIF24.
    16. "Neurl4, a novel daughter centriole protein, prevents formation of ectopic microtubule organizing centres."
      Li J., Kim S., Kobayashi T., Liang F.X., Korzeniewski N., Duensing S., Dynlacht B.D.
      EMBO Rep. 13:547-553(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH NEURL4 AND CCNF.
    17. "Interaction proteomics identify NEURL4 and the HECT E3 ligase HERC2 as novel modulators of centrosome architecture."
      Al-Hakim A.K., Bashkurov M., Gingras A.C., Durocher D., Pelletier L.
      Mol. Cell. Proteomics 11:M111.014233.01-M111.014233.14(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CEP97; HERC2 AND NEURL4.
    18. "USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110."
      Li J., D'Angiolella V., Seeley E.S., Kim S., Kobayashi T., Fu W., Campos E.I., Pagano M., Dynlacht B.D.
      Nature 495:255-259(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DEUBIQUITINATION, INTERACTION WITH USP20 AND USP33.

    Entry informationi

    Entry nameiCP110_HUMAN
    AccessioniPrimary (citable) accession number: O43303
    Secondary accession number(s): B7WP23
    , O43335, Q68DV9, Q8NE13
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 21, 2001
    Last sequence update: October 23, 2007
    Last modified: October 1, 2014
    This is version 121 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3