O43303 (CP110_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Centriolar coiled-coil protein of 110 kDa Alternative name(s): Centrosomal protein of 110 kDa Short name=CP110 Short name=Cep110 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1012 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Necessary for centrosome duplication at different stages of procentriole formation. Collaborates with CEP97, being involved in the suppression of a cilia assembly program. Required for correct spindle formation and has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CETN2. Ref.6 Ref.8 Ref.10 Ref.11 |
| Subunit structure | Interacts with CALM1, CETN2, CEP76 and CEP97. Interacts with CCNF. Ref.8 Ref.10 Ref.13 Ref.16 |
| Subcellular location | Cytoplasm › cytoskeleton › centrosome › centriole. Note: Recruited early and then associates with the growing distal tips. Ref.6 Ref.7 Ref.8 Ref.10 Ref.11 Ref.16 |
| Tissue specificity | Highly expressed in testis. Detected at intermediate levels in spleen, thymus, prostate, small intestine, colon and peripheral blood leukocytes. Ref.6 |
| Induction | Up-regulated during the transition from G1 to S phase of the cell cycle. The highest levels are observed in S phase, after which the levels decrease markedly. Ref.6 |
| Post-translational modification | Phosphorylated by CDKs. Ref.6 Ref.9 Ref.12 Ref.14 Ref.15 Ubiquitinated by the SCF(Cyclin F) during G2 phase, leading to its degradation by the proteasome and preventing centrosome reduplication. Ref.16 |
| Sequence caution | The sequence BAA24849.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein Ubl conjugation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | G2/M transition of mitotic cell cycle Traceable author statement. Source: Reactome centriole replicationInferred from mutant phenotype Ref.11. Source: UniProtKB regulation of cytokinesisInferred from mutant phenotype Ref.8. Source: UniProtKB |
| Cellular component | centriole Inferred from direct assay Ref.11Ref.16. Source: UniProtKB cytosolTraceable author statement. Source: Reactome |
| Molecular function | protein binding Inferred from physical interaction Ref.8Ref.13Ref.16. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CALM1 | P62158 | 9 | EBI-1566217,EBI-397435 | |
| CEP97 | Q8IW35 | 15 | EBI-1566217,EBI-1566210 | |
| CETN2 | P41208 | 3 | EBI-1566217,EBI-1789926 | |
| KIF24 | Q5T7B8 | 9 | EBI-1566217,EBI-2556811 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43303-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43303-2) The sequence of this isoform differs from the canonical sequence as follows: 968-1012: TPKTSVKGVVQNRQKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI → SICRKNPKKAAKCCDNLRRQHSLG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1012 | 1012 | Centriolar coiled-coil protein of 110 kDa | PRO_0000089460 | |||||
Regions | |||||||||
| Region | 1 – 223 | 223 | CEP97 binding | ||||||
| Region | 64 – 82 | 19 | Calmodulin-binding | ||||||
| Region | 350 – 565 | 216 | Interaction with CEP76 | ||||||
| Region | 781 – 821 | 41 | Calmodulin-binding | ||||||
| Region | 909 – 924 | 16 | Calmodulin-binding | ||||||
| Coiled coil | 49 – 90 | 42 | Potential | ||||||
| Coiled coil | 640 – 709 | 70 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 366 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 370 | 1 | Phosphoserine Ref.12 Ref.14 | ||||||
| Modified residue | 372 | 1 | Phosphoserine Ref.12 Ref.15 | ||||||
| Modified residue | 641 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 968 – 1012 | 45 | TPKTS…NVATI → SICRKNPKKAAKCCDNLRRQ HSLG in isoform 2. | VSP_011897 | |||||
| Natural variant | 69 | 1 | R → S. Corresponds to variant rs16972129 [ dbSNP | Ensembl ]. | VAR_056788 | |||||
| Natural variant | 171 | 1 | P → L. Corresponds to variant rs3751821 [ dbSNP | Ensembl ]. | VAR_056789 | |||||
| Natural variant | 252 | 1 | I → M. Ref.1 Ref.2 Ref.3 Ref.5 Corresponds to variant rs226891 [ dbSNP | Ensembl ]. | VAR_019823 | |||||
| Natural variant | 347 | 1 | F → I. Ref.1 Corresponds to variant rs11645625 [ dbSNP | Ensembl ]. | VAR_056790 | |||||
| Natural variant | 375 | 1 | M → I. Corresponds to variant rs7190666 [ dbSNP | Ensembl ]. | VAR_019824 | |||||
Experimental info | |||||||||
| Mutagenesis | 586 – 588 | 3 | RRL → ARA: Abolishes interaction with CCNF. Ref.16 | ||||||
| Sequence conflict | 628 | 1 | V → F in AAH36654. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro." Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 4:307-313(1997) [PubMed: 9455477] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS MET-252 AND ILE-347. Tissue: Brain. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-252. Tissue: Fetal kidney. |
| [3] | "Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q." Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Cronin L., Mays A.D., Cao Y., Xu R.X., Kang H.-L., Mitchell S., Eichler E.E., Harris P.C., Venter J.C., Adams M.D. Genomics 60:295-308(1999) [PubMed: 10493829] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT MET-252. |
| [4] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed: 15616553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT MET-252. Tissue: Testis. |
| [6] | "CP110, a cell cycle-dependent CDK substrate, regulates centrosome duplication in human cells." Chen Z., Indjeian V.B., McManus M., Wang L., Dynlacht B.D. Dev. Cell 3:339-350(2002) [PubMed: 12361598] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION, PHOSPHORYLATION. |
| [7] | "Proteomic characterization of the human centrosome by protein correlation profiling." Andersen J.S., Wilkinson C.J., Mayor T., Mortensen P., Nigg E.A., Mann M. Nature 426:570-574(2003) [PubMed: 14654843] [Abstract] Cited for: MASS SPECTROMETRY, SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS]. Tissue: Lymphoblast. |
| [8] | "CP110 cooperates with two calcium-binding proteins to regulate cytokinesis and genome stability." Tsang W.Y., Spektor A., Luciano D.J., Indjeian V.B., Chen Z., Salisbury J.L., Sanchez I., Dynlacht B.D. Mol. Biol. Cell 17:3423-3434(2006) [PubMed: 16760425] [Abstract] Cited for: FUNCTION, INTERACTION WITH CALM1 AND CETN2, SUBCELLULAR LOCATION. |
| [9] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-641, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Cep97 and CP110 suppress a cilia assembly program." Spektor A., Tsang W.Y., Khoo D., Dynlacht B.D. Cell 130:678-690(2007) [PubMed: 17719545] [Abstract] Cited for: FUNCTION, INTERACTION WITH CALM1 AND CEP97, SUBCELLULAR LOCATION. |
| [11] | "Plk4-induced centriole biogenesis in human cells." Kleylein-Sohn J., Westendorf J., Le Clech M., Habedanck R., Stierhof Y.-D., Nigg E.A. Dev. Cell 13:190-202(2007) [PubMed: 17681131] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [12] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-366; SER-370 AND SER-372, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [13] | "Cep76, a centrosomal protein that specifically restrains centriole reduplication." Tsang W.Y., Spektor A., Vijayakumar S., Bista B.R., Li J., Sanchez I., Duensing S., Dynlacht B.D. Dev. Cell 16:649-660(2009) [PubMed: 19460342] [Abstract] Cited for: INTERACTION WITH CEP76. |
| [14] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-370, MASS SPECTROMETRY. |
| [15] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-372, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [16] | "SCF(Cyclin F) controls centrosome homeostasis and mitotic fidelity through CP110 degradation." D'Angiolella V., Donato V., Vijayakumar S., Saraf A., Florens L., Washburn M.P., Dynlacht B., Pagano M. Nature 466:138-142(2010) [PubMed: 20596027] [Abstract] Cited for: UBIQUITINATION, SUBCELLULAR LOCATION, MUTAGENESIS OF 586-ARG--LEU-588, INTERACTION WITH CCNF. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB007879 mRNA. Translation: BAA24849.2. Different initiation. CR749255 mRNA. Translation: CAH18111.1. AC003108 Genomic DNA. Translation: AAC05804.1. AC012621 Genomic DNA. No translation available. BC036654 mRNA. Translation: AAH36654.1. |
| IPI | IPI00011933. IPI00478736. |
| PIR | T01372. |
| RefSeq | NP_001185951.1. NM_001199022.1. NP_055526.3. NM_014711.4. |
| UniGene | Hs.279912. |
3D structure databases | |
| ProteinModelPortal | O43303. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O43303. 12 interactions. |
| STRING | O43303. |
PTM databases | |
| PhosphoSite | O43303. |
Proteomic databases | |
| PRIDE | O43303. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000219827; ENSP00000219827; ENSG00000103540. ENST00000381396; ENSP00000370803; ENSG00000103540. ENST00000396208; ENSP00000379511; ENSG00000103540. ENST00000396212; ENSP00000379515; ENSG00000103540. |
| GeneID | 9738. |
| KEGG | hsa:9738. |
| UCSC | uc002dgk.2. human. uc002dgl.2. human. |
Organism-specific databases | |
| CTD | 9738. |
| GeneCards | GC16P019536. |
| HGNC | HGNC:24342. CCP110. |
| HPA | HPA039402. |
| MIM | 609544. gene. |
| neXtProt | NX_O43303. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG05924. |
| GeneTree | ENSGT00390000004090. |
| HOGENOM | HBG278100. |
| HOVERGEN | HBG050873. |
| InParanoid | O43303. |
| OMA | KDTMEFI. |
| OrthoDB | EOG40ZQX3. |
Enzyme and pathway databases | |
| Reactome | REACT_152. Cell Cycle, Mitotic. |
Gene expression databases | |
| ArrayExpress | O43303. |
| Bgee | O43303. |
| CleanEx | HS_CEP110. |
| Genevestigator | O43303. |
| GermOnline | ENSG00000103540. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | CP110_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43303 Secondary accession number(s): B7WP23 Q8NE13 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with