Reviewed,
UniProtKB/Swiss-Prot O43303 (CE110_HUMAN)
Last modified
July 7, 2009.
Version 66.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Centrosomal protein of 110 kDa Short name=Cep110 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1012 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Necessary for centrosome duplication. Collaborates with CEP97, being involved in the suppression of a cilia assembly program. Required for correct spindle formation and has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CETN2. Ref.6 Ref.8 Ref.10 |
| Subunit structure | Interacts with CALM1, CETN2, CEP76 and CEP97. |
| Subcellular location | |
| Tissue specificity | Highly expressed in testis. Detected at intermediate levels in spleen, thymus, prostate, small intestine, colon and peripheral blood leukocytes. Ref.6 |
| Induction | Up-regulated during the transition from G1 to S phase of the cell cycle. The highest levels are observed in S phase, after which the levels decrease markedly. Ref.6 |
| Post-translational modification |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | centrosome duplication Ref.8 Inferred from mutant phenotype. Source: UniProtKB regulation of cytokinesis Ref.8Inferred from mutant phenotype. Source: UniProtKB |
| Cellular component | centrosome Ref.8 Inferred from direct assay. Source: UniProtKB |
| Molecular function | protein binding Ref.6 Ref.8 Ref.10 Inferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CALM1 | P62158 | 5 | EBI-1566217,EBI-397435 | |
| CEP97 | Q8IW35 | 5 | EBI-1566217,EBI-1566210 | |
| CETN2 | P41208 | 2 | EBI-1566217,EBI-1789926 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43303-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43303-2) The sequence of this isoform differs from the canonical sequence as follows: 968-1012: TPKTSVKGVVQNRQKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI → SICRKNPKKAAKCCDNLRRQHSLG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1012 | 1012 | Centrosomal protein of 110 kDa | PRO_0000089460 | |||||
Regions | |||||||||
| Region | 1 – 223 | 223 | CEP97 binding | ||||||
| Region | 64 – 82 | 19 | Calmodulin-binding | ||||||
| Region | 350 – 565 | 216 | Interaction with CEP76 | ||||||
| Region | 781 – 821 | 41 | Calmodulin-binding | ||||||
| Region | 909 – 924 | 16 | Calmodulin-binding | ||||||
| Coiled coil | 49 – 90 | 42 | Potential | ||||||
| Coiled coil | 640 – 709 | 70 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 641 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 968 – 1012 | 45 | TPKTS…NVATI → SICRKNPKKAAKCCDNLRRQ HSLG in isoform 2. | VSP_011897 | |||||
| Natural variant | 69 | 1 | R → S: dbSNP rs16972129. | VAR_056788 | |||||
| Natural variant | 171 | 1 | P → L: dbSNP rs3751821. | VAR_056789 | |||||
| Natural variant | 252 | 1 | I → M: dbSNP rs226891. Ref.1 Ref.2 Ref.3 Ref.5 | VAR_019823 | |||||
| Natural variant | 347 | 1 | F → I: dbSNP rs11645625. | VAR_056790 | |||||
| Natural variant | 375 | 1 | M → I: dbSNP rs7190666. | VAR_019824 | |||||
Experimental info | |||||||||
| Sequence conflict | 628 | 1 | V → F in AAH36654. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro." Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 4:307-313(1997) [PubMed: 9455477] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS MET-252 AND ILE-347. Tissue: Brain. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Blocker H., Heubner D., Hoerlein A., Michel G., Wedler H., Kohrer K., Ottenwalder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-252. Tissue: Fetal kidney. |
| [3] | "Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q." Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Cronin L., Mays A.D., Cao Y., Xu R.X., Kang H.-L., Mitchell S., Eichler E.E., Harris P.C., Venter J.C., Adams M.D. Genomics 60:295-308(1999) [PubMed: 10493829] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT MET-252. |
| [4] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed: 15616553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT MET-252. Tissue: Testis. |
| [6] | "CP110, a cell cycle-dependent CDK substrate, regulates centrosome duplication in human cells." Chen Z., Indjeian V.B., McManus M., Wang L., Dynlacht B.D. Dev. Cell 3:339-350(2002) [PubMed: 12361598] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION, PHOSPHORYLATION. |
| [7] | "Proteomic characterization of the human centrosome by protein correlation profiling." Andersen J.S., Wilkinson C.J., Mayor T., Mortensen P., Nigg E.A., Mann M. Nature 426:570-574(2003) [PubMed: 14654843] [Abstract] Cited for: MASS SPECTROMETRY, SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS]. |
| [8] | "CP110 cooperates with two calcium-binding proteins to regulate cytokinesis and genome stability." Tsang W.Y., Spektor A., Luciano D.J., Indjeian V.B., Chen Z., Salisbury J.L., Sanchez I., Dynlacht B.D. Mol. Biol. Cell 17:3423-3434(2006) [PubMed: 16760425] [Abstract] Cited for: FUNCTION, INTERACTION WITH CALM1 AND CETN2, SUBCELLULAR LOCATION. |
| [9] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-641, MASS SPECTROMETRY. Tissue: Epithelium. |
| [10] | "Cep97 and CP110 suppress a cilia assembly program." Spektor A., Tsang W.Y., Khoo D., Dynlacht B.D. Cell 130:678-690(2007) [PubMed: 17719545] [Abstract] Cited for: FUNCTION, INTERACTION WITH CALM1 AND CEP97, SUBCELLULAR LOCATION. |
| [11] | "Cep76, a centrosomal protein that specifically restrains centriole reduplication." Tsang W.Y., Spektor A., Vijayakumar S., Bista B.R., Li J., Sanchez I., Duensing S., Dynlacht B.D. Dev. Cell 16:649-660(2009) [PubMed: 19460342] [Abstract] Cited for: INTERACTION WITH CEP76. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AB007879 mRNA. Translation: BAA24849.2. Different initiation. CR749255 mRNA. Translation: CAH18111.1. AC003108 Genomic DNA. Translation: AAC05804.1. AC012621 Genomic DNA. No translation available. BC036654 mRNA. Translation: AAH36654.1. | |
| IPI | IPI00011933. IPI00478736. |
| PIR | T01372. |
| RefSeq | NP_055526.3. |
| UniGene | Hs.279912 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O43303. 6 interactions. |
PTM databases | |
| PhosphoSite | O43303. |
Genome annotation databases | |
| Ensembl | ENSG00000103540. Homo sapiens. [Contig view] |
| GeneID | 9738. |
| KEGG | hsa:9738. |
| UCSC | uc002dgk.2. human. uc002dgl.2. human. |
Organism-specific databases | |
| GeneCards | GC09P122877. GC16P019442. |
| H-InvDB | HIX0019147. |
| MIM | 609544. gene. |
| HUGE | Search... |
Phylogenomic databases | |
| HOGENOM | O43303. |
| HOVERGEN | O43303. |
| OMA | O43303. NACELSP. |
Enzyme and pathway databases | |
| Reactome | REACT_152. Cell Cycle, Mitotic. |
Gene expression databases | |
| ArrayExpress | O43303. |
| Bgee | O43303. |
| CleanEx | HS_CEP110. |
| GermOnline | ENSG00000103540. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | CE110_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43303 Secondary accession number(s): O43335, Q68DV9, Q8NE13 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with


