Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O43295

- SRGP3_HUMAN

UniProt

O43295 - SRGP3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

SLIT-ROBO Rho GTPase-activating protein 3

Gene

SRGAP3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

GTPase-activating protein for RAC1 and perhaps Cdc42, but not for RhoA small GTPase. May attenuate RAC1 signaling in neurons.2 Publications

GO - Molecular functioni

  1. GTPase activator activity Source: UniProtKB-KW

GO - Biological processi

  1. regulation of small GTPase mediated signal transduction Source: Reactome
  2. small GTPase mediated signal transduction Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.
REACT_19342. Inactivation of Cdc42 and Rac.

Names & Taxonomyi

Protein namesi
Recommended name:
SLIT-ROBO Rho GTPase-activating protein 3
Short name:
srGAP3
Alternative name(s):
Mental disorder-associated GAP
Rho GTPase-activating protein 14
WAVE-associated Rac GTPase-activating protein
Short name:
WRP
Gene namesi
Name:SRGAP3
Synonyms:ARHGAP14, KIAA0411, KIAA1156, MEGAP, SRGAP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:19744. SRGAP3.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving SRGAP3 is found in a patient with severe idiopathic mental retardation. Translocation t(X;3)(p11.2;p25).

Organism-specific databases

Orphaneti251612. Pilocytic astrocytoma.
PharmGKBiPA134935463.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10991099SLIT-ROBO Rho GTPase-activating protein 3PRO_0000056769Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei837 – 8371Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO43295.
PaxDbiO43295.
PRIDEiO43295.

PTM databases

PhosphoSiteiO43295.

Expressioni

Tissue specificityi

Highly expressed in adult and fetal brain. Expressed at low levels in kidney. Isoform 3 is expressed in the kidney but is absent in the brain.2 Publications

Gene expression databases

BgeeiO43295.
CleanExiHS_SRGAP2.
HS_SRGAP3.
GenevestigatoriO43295.

Organism-specific databases

HPAiHPA036959.

Interactioni

Subunit structurei

Homodimer (Probable). Forms a heterooligomer with SRGAP1 and SRGAP2 through its F-BAR domain. Interacts with WASF1. Probably interacts with ROBO1. Interacts with FASLG.3 PublicationsCurated

Binary interactionsi

WithEntry#Exp.IntActNotes
HTTP428584EBI-368166,EBI-466029

Protein-protein interaction databases

BioGridi115230. 17 interactions.
IntActiO43295. 8 interactions.
MINTiMINT-2795945.
STRINGi9606.ENSP00000373347.

Structurei

3D structure databases

ProteinModelPortaliO43295.
SMRiO43295. Positions 26-337, 502-693, 749-800.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 8766FCHPROSITE-ProRule annotationAdd
BLAST
Domaini482 – 670189Rho-GAPPROSITE-ProRule annotationAdd
BLAST
Domaini720 – 77960SH3PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 492492F-BAR domainAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili352 – 39241Sequence AnalysisAdd
BLAST
Coiled coili952 – 98736Sequence AnalysisAdd
BLAST

Domaini

The F-BAR domain mediates oligomerization, binds membranes, and induces plasma membrane protrusions.

Sequence similaritiesi

Contains 1 FCH domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiNOG264793.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000039980.
HOVERGENiHBG051637.
InParanoidiO43295.
KOiK07526.
OMAiIQQILIT.
OrthoDBiEOG7966FQ.
PhylomeDBiO43295.
TreeFamiTF315892.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR001060. FCH_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00611. FCH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS50133. FCH. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O43295-1) [UniParc]FASTAAdd to Basket

Also known as: MEGAPa, srGAP3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSQTKFKKD KEIIAEYEAQ IKEIRTQLVE QFKCLEQQSE SRLQLLQDLQ
60 70 80 90 100
EFFRRKAEIE LEYSRSLEKL AERFSSKIRS SREHQFKKDQ YLLSPVNCWY
110 120 130 140 150
LVLHQTRRES RDHATLNDIF MNNVIVRLSQ ISEDVIRLFK KSKEIGLQMH
160 170 180 190 200
EELLKVTNEL YTVMKTYHMY HAESISAESK LKEAEKQEEK QFNKSGDLSM
210 220 230 240 250
NLLRHEDRPQ RRSSVKKIEK MKEKRQAKYS ENKLKCTKAR NDYLLNLAAT
260 270 280 290 300
NAAISKYYIH DVSDLIDCCD LGFHASLART FRTYLSAEYN LETSRHEGLD
310 320 330 340 350
VIENAVDNLD SRSDKHTVMD MCNQVFCPPL KFEFQPHMGD EVCQVSAQQP
360 370 380 390 400
VQTELLMRYH QLQSRLATLK IENEEVRKTL DATMQTLQDM LTVEDFDVSD
410 420 430 440 450
AFQHSRSTES VKSAASETYM SKINIAKRRA NQQETEMFYF TKFKEYVNGS
460 470 480 490 500
NLITKLQAKH DLLKQTLGEG ERAECGTTRP PCLPPKPQKM RRPRPLSVYS
510 520 530 540 550
HKLFNGSMEA FIKDSGQAIP LVVESCIRYI NLYGLQQQGI FRVPGSQVEV
560 570 580 590 600
NDIKNSFERG EDPLVDDQNE RDINSVAGVL KLYFRGLENP LFPKERFQDL
610 620 630 640 650
ISTIKLENPA ERVHQIQQIL VTLPRVVIVV MRYLFAFLNH LSQYSDENMM
660 670 680 690 700
DPYNLAICFG PTLMHIPDGQ DPVSCQAHIN EVIKTIIIHH EAIFPSPREL
710 720 730 740 750
EGPVYEKCMA GGEEYCDSPH SEPGAIDEVD HDNGTEPHTS DEEVEQIEAI
760 770 780 790 800
AKFDYMGRSP RELSFKKGAS LLLYHRASED WWEGRHNGVD GLIPHQYIVV
810 820 830 840 850
QDMDDAFSDS LSQKADSEAS SGPLLDDKAS SKNDLQSPTE HISDYGFGGV
860 870 880 890 900
MGRVRLRSDG AAIPRRRSGG DTHSPPRGLG PSIDTPPRAA ACPSSPHKIP
910 920 930 940 950
LTRGRIESPE KRRMATFGSA GSINYPDKKA LSEGHSMRST CGSTRHSSLG
960 970 980 990 1000
DHKSLEAEAL AEDIEKTMST ALHELRELER QNTVKQAPDV VLDTLEPLKN
1010 1020 1030 1040 1050
PPGPVSSEPA SPLHTIVIRD PDAAMRRSSS SSTEMMTTFK PALSARLAGA
1060 1070 1080 1090
QLRPPPMRPV RPVVQHRSSS SSSSGVGSPA VTPTEKMFPN SSADKSGTM
Length:1,099
Mass (Da):124,504
Last modified:June 7, 2004 - v3
Checksum:i2D1BA2D338E1BF13
GO
Isoform 2 (identifier: O43295-2) [UniParc]FASTAAdd to Basket

Also known as: MEGAPb, srGAP3b

The sequence of this isoform differs from the canonical sequence as follows:
     480-513: PPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIK → GRRNARTRNQ

Show »
Length:1,075
Mass (Da):121,780
Checksum:i442CA4D408B1F157
GO
Isoform 3 (identifier: O43295-3) [UniParc]FASTAAdd to Basket

Also known as: MEGAPc, srGAP3c

The sequence of this isoform differs from the canonical sequence as follows:
     480-489: PPCLPPKPQK → IQDKLYRL
     490-1099: Missing.

Show »
Length:487
Mass (Da):57,227
Checksum:i1C99D701F9A3563B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti623 – 6231L → I in a breast cancer sample; somatic mutation. 1 Publication
VAR_035550
Natural varianti628 – 6281I → V.
Corresponds to variant rs2271207 [ dbSNP | Ensembl ].
VAR_049159

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei480 – 51334PPCLP…EAFIK → GRRNARTRNQ in isoform 2. 2 PublicationsVSP_010581Add
BLAST
Alternative sequencei480 – 48910PPCLPPKPQK → IQDKLYRL in isoform 3. CuratedVSP_010582
Alternative sequencei490 – 1099610Missing in isoform 3. CuratedVSP_010583Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF464189 mRNA. Translation: AAN57784.1.
AF427144 mRNA. Translation: AAN07095.1.
AB007871 mRNA. Translation: BAA24841.2.
CCDSiCCDS2572.1. [O43295-1]
CCDS33689.1. [O43295-2]
RefSeqiNP_001028289.1. NM_001033117.2. [O43295-2]
NP_055665.1. NM_014850.3. [O43295-1]
UniGeneiHs.654743.

Genome annotation databases

EnsembliENST00000360413; ENSP00000353587; ENSG00000196220. [O43295-2]
ENST00000383836; ENSP00000373347; ENSG00000196220. [O43295-1]
GeneIDi9901.
KEGGihsa:9901.
UCSCiuc003brf.2. human. [O43295-1]
uc003brg.2. human. [O43295-2]
uc003brk.4. human. [O43295-3]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF464189 mRNA. Translation: AAN57784.1 .
AF427144 mRNA. Translation: AAN07095.1 .
AB007871 mRNA. Translation: BAA24841.2 .
CCDSi CCDS2572.1. [O43295-1 ]
CCDS33689.1. [O43295-2 ]
RefSeqi NP_001028289.1. NM_001033117.2. [O43295-2 ]
NP_055665.1. NM_014850.3. [O43295-1 ]
UniGenei Hs.654743.

3D structure databases

ProteinModelPortali O43295.
SMRi O43295. Positions 26-337, 502-693, 749-800.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115230. 17 interactions.
IntActi O43295. 8 interactions.
MINTi MINT-2795945.
STRINGi 9606.ENSP00000373347.

PTM databases

PhosphoSitei O43295.

Proteomic databases

MaxQBi O43295.
PaxDbi O43295.
PRIDEi O43295.

Protocols and materials databases

DNASUi 9901.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000360413 ; ENSP00000353587 ; ENSG00000196220 . [O43295-2 ]
ENST00000383836 ; ENSP00000373347 ; ENSG00000196220 . [O43295-1 ]
GeneIDi 9901.
KEGGi hsa:9901.
UCSCi uc003brf.2. human. [O43295-1 ]
uc003brg.2. human. [O43295-2 ]
uc003brk.4. human. [O43295-3 ]

Organism-specific databases

CTDi 9901.
GeneCardsi GC03M008998.
HGNCi HGNC:19744. SRGAP3.
HPAi HPA036959.
MIMi 606525. gene.
neXtProti NX_O43295.
Orphaneti 251612. Pilocytic astrocytoma.
PharmGKBi PA134935463.
HUGEi Search...
Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG264793.
GeneTreei ENSGT00760000118863.
HOGENOMi HOG000039980.
HOVERGENi HBG051637.
InParanoidi O43295.
KOi K07526.
OMAi IQQILIT.
OrthoDBi EOG7966FQ.
PhylomeDBi O43295.
TreeFami TF315892.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.
REACT_19342. Inactivation of Cdc42 and Rac.

Miscellaneous databases

ChiTaRSi SRGAP3. human.
GeneWikii SRGAP3.
GenomeRNAii 9901.
NextBioi 37331.
PROi O43295.
SOURCEi Search...

Gene expression databases

Bgeei O43295.
CleanExi HS_SRGAP2.
HS_SRGAP3.
Genevestigatori O43295.

Family and domain databases

Gene3Di 1.10.555.10. 1 hit.
InterProi IPR001060. FCH_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF00611. FCH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view ]
SMARTi SM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF48350. SSF48350. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEi PS50133. FCH. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The WRP component of the WAVE-1 complex attenuates Rac-mediated signalling."
    Soderling S.H., Binns K.L., Wayman G.A., Davee S.M., Ong S.H., Pawson T., Scott J.D.
    Nat. Cell Biol. 4:970-975(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH WASF1.
  2. "The novel Rho-GTPase activating gene MEGAP/ srGAP3 has a putative role in severe mental retardation."
    Endris V., Wogatzky B., Leimer U., Bartsch D., Zatyka M., Latif F., Maher E.R., Tariverdian G., Kirsch S., Karch D., Rappold G.A.
    Proc. Natl. Acad. Sci. U.S.A. 99:11754-11759(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY, CHROMOSOMAL TRANSLOCATION.
  3. "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro."
    Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 4:307-313(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 15-1099 (ISOFORM 2).
    Tissue: Brain.
  4. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  5. "Signal transduction in neuronal migration: roles of GTPase activating proteins and the small GTPase Cdc42 in the Slit-Robo pathway."
    Wong K., Ren X.R., Huang Y.Z., Xie Y., Liu G., Saito H., Tang H., Wen L., Brady-Kalnay S.M., Mei L., Wu J.Y., Xiong W.C., Rao Y.
    Cell 107:209-221(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ROBO1.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Platelet.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-837, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
    Voss M., Lettau M., Janssen O.
    BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FASLG.
  9. Cited for: VARIANT [LARGE SCALE ANALYSIS] ILE-623.

Entry informationi

Entry nameiSRGP3_HUMAN
AccessioniPrimary (citable) accession number: O43295
Secondary accession number(s): Q8IX13, Q8IZV8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: June 7, 2004
Last modified: October 29, 2014
This is version 138 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3