O43292 (GPAA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glycosylphosphatidylinositol anchor attachment 1 protein Short name=GPI anchor attachment protein 1 Alternative name(s): GAA1 protein homolog Short name=hGAA1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 621 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Essential for GPI-anchoring of precursor proteins but not for GPI synthesis. Acts before or during formation of the carbonyl intermediate. Ref.1 |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis. |
| Subunit structure | Forms a complex with PIGK/GPI8, PIGT, PIGU and PIGS. Ref.5 |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.5. |
| Tissue specificity | Ubiquitously expressed in fetal and adult tissues. Expressed at higher levels in fetal tissues than adult tissues. Ref.1 |
| Sequence caution | The sequence CAB75660.2 differs from that shown. Reason: Erroneous gene model prediction. Erroneous prediction from an unspliced cDNA. |
Ontologies
| Keywords | |
|---|---|
| Biological process | GPI-anchor biosynthesis |
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | C-terminal protein lipidation Traceable author statement. Source: Reactome attachment of GPI anchor to proteinNon-traceable author statement Ref.1. Source: UniProtKB protein complex assemblyNon-traceable author statement PubMed 14660601. Source: UniProtKB protein retention in ER lumenNon-traceable author statement PubMed 12052837. Source: UniProtKB |
| Cellular_component | GPI-anchor transamidase complex Traceable author statement PubMed 15713669. Source: UniProtKB |
| Molecular_function | tubulin binding Non-traceable author statement PubMed 12052837. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43292-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43292-2) The sequence of this isoform differs from the canonical sequence as follows: 25-85: CVLSYVAGIAWFLALVFPPLTQRTYMSENAMGSTMVEEQFAGGDRARAFARDFAAHRKKSG → W |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.5 | ||||||
| Chain | 2 – 621 | 620 | Glycosylphosphatidylinositol anchor attachment 1 protein | PRO_0000087554 | |||||
Regions | |||||||||
| Topological domain | 2 – 24 | 23 | Cytoplasmic Potential | ||||||
| Transmembrane | 25 – 45 | 21 | Helical; Potential | ||||||
| Topological domain | 46 – 368 | 323 | Lumenal Potential | ||||||
| Transmembrane | 369 – 389 | 21 | Helical; Potential | ||||||
| Topological domain | 390 – 427 | 38 | Cytoplasmic Potential | ||||||
| Transmembrane | 428 – 448 | 21 | Helical; Potential | ||||||
| Topological domain | 449 – 458 | 10 | Lumenal Potential | ||||||
| Transmembrane | 459 – 479 | 21 | Helical; Potential | ||||||
| Topological domain | 480 – 495 | 16 | Cytoplasmic Potential | ||||||
| Transmembrane | 496 – 516 | 21 | Helical; Potential | ||||||
| Topological domain | 517 – 543 | 27 | Lumenal Potential | ||||||
| Transmembrane | 544 – 564 | 21 | Helical; Potential | ||||||
| Topological domain | 565 – 599 | 35 | Cytoplasmic Potential | ||||||
| Transmembrane | 600 – 620 | 21 | Helical; Potential | ||||||
| Topological domain | 621 | 1 | Lumenal Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 203 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 517 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 25 – 85 | 61 | CVLSY…RKKSG → W in isoform 2. | VSP_009542 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of human homolog of yeast GAA1 which is required for attachment of glycosylphosphatidylinositols to proteins." Hiroi Y., Komuro I., Chen R., Hosoda T., Mizuno T., Kudoh S., Georgescu S.P., Medof M.E., Yazaki Y. FEBS Lett. 421:252-258(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. Tissue: Heart. |
| [2] | "Human and mouse GPAA1 (glycosylphosphatidylinositol anchor attachment 1) genes: genomic structures, chromosome loci and the presence of a minor class intron." Inoue N., Ohishi K., Endo Y., Fujita T., Takeda J., Kinoshita T. Cytogenet. Cell Genet. 84:199-205(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1). Tissue: Lung. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Muscle, Placenta and Skin. |
| [5] | "PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8." Ohishi K., Inoue N., Kinoshita T. EMBO J. 20:4088-4098(2001) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-21, SUBUNIT, SUBCELLULAR LOCATION, MEMBRANE TOPOLOGY. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB006969 mRNA. Translation: BAA24035.1. AB002135 mRNA. Translation: BAA82588.1. AB002137 Genomic DNA. Translation: BAA82590.1. AB017267 Genomic DNA. Translation: BAA82587.1. AL157437 mRNA. Translation: CAB75660.2. Sequence problems. BC003171 mRNA. Translation: AAH03171.1. BC004129 mRNA. Translation: AAH04129.1. BC006383 mRNA. Translation: AAH06383.2. |
| IPI | IPI00021594. IPI00400944. |
| PIR | T46923. |
| RefSeq | NP_003792.1. NM_003801.3. |
| UniGene | Hs.627962. |
3D structure databases | |
| ProteinModelPortal | O43292. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O43292. 4 interactions. |
| MINT | MINT-1385413. |
| STRING | 9606.ENSP00000347206. |
PTM databases | |
| PhosphoSite | O43292. |
Proteomic databases | |
| PaxDb | O43292. |
| PRIDE | O43292. |
Protocols and materials databases | |
| DNASU | 8733. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000355091; ENSP00000347206; ENSG00000197858. ENST00000361036; ENSP00000354316; ENSG00000197858. ENST00000562454; ENSP00000457816; ENSG00000260226. ENST00000564504; ENSP00000456208; ENSG00000260226. |
| GeneID | 8733. |
| KEGG | hsa:8733. |
| UCSC | uc003zaw.1. human. uc003zax.3. human. |
Organism-specific databases | |
| CTD | 8733. |
| GeneCards | GC08P145137. |
| HGNC | HGNC:4446. GPAA1. |
| MIM | 603048. gene. |
| neXtProt | NX_O43292. |
| PharmGKB | PA28827. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG273269. |
| HOGENOM | HOG000045628. |
| HOVERGEN | HBG051793. |
| InParanoid | O43292. |
| KO | K05289. |
| OMA | FWNILFW. |
Enzyme and pathway databases | |
| Reactome | REACT_17015. Metabolism of proteins. |
| UniPathway | UPA00196. |
Gene expression databases | |
| ArrayExpress | O43292. |
| Bgee | O43292. |
| CleanEx | HS_GPAA1. |
| Genevestigator | O43292. |
| GermOnline | ENSG00000197858. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007246. Gaa1. IPR017063. GPI_prot_transamidse_cplx_GAA1. [Graphical view] |
| PANTHER | PTHR13304. PTHR13304. 1 hit. |
| Pfam | PF04114. Gaa1. 1 hit. [Graphical view] |
| PIRSF | PIRSF036762. GAA1. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 8733. |
| NextBio | 32761. |
| SOURCE | Search... |
Entry information
| Entry name | GPAA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43292 Secondary accession number(s): Q9NSS0, Q9UQ31 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |

Clusters with
