Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O43280

- TREA_HUMAN

UniProt

O43280 - TREA_HUMAN

Protein

Trehalase

Gene

TREH

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 124 (01 Oct 2014)
      Sequence version 2 (23 Sep 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose.

    Catalytic activityi

    Alpha,alpha-trehalose + H2O = beta-D-glucose + alpha-D-glucose.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei168 – 1681SubstrateBy similarity
    Binding sitei212 – 2121SubstrateBy similarity
    Binding sitei319 – 3191Substrate; via carbonyl oxygenBy similarity
    Active sitei321 – 3211Proton donor/acceptorBy similarity
    Active sitei514 – 5141Proton donor/acceptorBy similarity
    Binding sitei529 – 5291SubstrateBy similarity

    GO - Molecular functioni

    1. alpha,alpha-trehalase activity Source: UniProtKB

    GO - Biological processi

    1. carbohydrate metabolic process Source: Reactome
    2. organ morphogenesis Source: Ensembl
    3. polysaccharide digestion Source: Reactome
    4. small molecule metabolic process Source: Reactome
    5. trehalose catabolic process Source: ProtInc
    6. trehalose metabolic process Source: UniProtKB

    Keywords - Molecular functioni

    Glycosidase, Hydrolase

    Enzyme and pathway databases

    ReactomeiREACT_9472. Digestion of dietary carbohydrate.

    Protein family/group databases

    CAZyiGH37. Glycoside Hydrolase Family 37.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Trehalase (EC:3.2.1.28)
    Alternative name(s):
    Alpha,alpha-trehalase
    Alpha,alpha-trehalose glucohydrolase
    Gene namesi
    Name:TREH
    Synonyms:TREA
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:12266. TREH.

    Subcellular locationi

    Cell membrane By similarity; Lipid-anchorGPI-anchor By similarity

    GO - Cellular componenti

    1. anchored component of plasma membrane Source: UniProtKB
    2. extracellular vesicular exosome Source: UniProt
    3. plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Deficiency of TREH results in isolated trehalose intolerance that causes gastrointestinal symptoms after ingestion of edible mushrooms.

    Organism-specific databases

    Orphaneti103909. Diarrhea-vomiting due to trehalase deficiency.
    PharmGKBiPA36946.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2323Sequence AnalysisAdd
    BLAST
    Chaini24 – 556533TrehalasePRO_0000012051Add
    BLAST
    Propeptidei557 – 58327Removed in mature formBy similarityPRO_0000012052Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi78 – 781N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi239 – 2391N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi261 – 2611N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi369 – 3691N-linked (GlcNAc...)Sequence Analysis
    Lipidationi556 – 5561GPI-anchor amidated serineSequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

    Proteomic databases

    PaxDbiO43280.
    PRIDEiO43280.

    PTM databases

    PhosphoSiteiO43280.

    Expressioni

    Gene expression databases

    ArrayExpressiO43280.
    BgeeiO43280.
    CleanExiHS_TREH.
    GenevestigatoriO43280.

    Organism-specific databases

    HPAiHPA039913.

    Interactioni

    Subunit structurei

    Homodimer; disulfide-linked.By similarity

    Protein-protein interaction databases

    STRINGi9606.ENSP00000264029.

    Structurei

    3D structure databases

    ProteinModelPortaliO43280.
    SMRiO43280. Positions 36-548.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni175 – 1762Substrate bindingBy similarity
    Regioni221 – 2233Substrate bindingBy similarity
    Regioni286 – 2883Substrate bindingBy similarity

    Sequence similaritiesi

    Belongs to the glycosyl hydrolase 37 family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG1626.
    HOGENOMiHOG000215465.
    HOVERGENiHBG014956.
    InParanoidiO43280.
    KOiK01194.
    PhylomeDBiO43280.
    TreeFamiTF314239.

    Family and domain databases

    InterProiIPR008928. 6-hairpin_glycosidase-like.
    IPR001661. Glyco_hydro_37.
    IPR018232. Glyco_hydro_37_CS.
    [Graphical view]
    PANTHERiPTHR23403. PTHR23403. 1 hit.
    PfamiPF01204. Trehalase. 1 hit.
    [Graphical view]
    PRINTSiPR00744. GLHYDRLASE37.
    SUPFAMiSSF48208. SSF48208. 1 hit.
    PROSITEiPS00927. TREHALASE_1. 1 hit.
    PS00928. TREHALASE_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O43280-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPGRTWELCL LLLLGLGLGS QEALPPPCES EIYCHGELLN QVQMAKLYQD    50
    DKQFVDMPLS IAPEQVLQTF TELSRDHNHS IPREQLQAFV HEHFQAKGQE 100
    LQPWTPADWK DSPQFLQKIS DAKLRAWAGQ LHQLWKKLGK KMKPEVLSHP 150
    ERFSLIYSEH PFIVPGGRFV EFYYWDSYWV MEGLLLSEMA ETVKGMLQNF 200
    LDLVKTYGHV PNGGRVYYLQ RSQPPLLTLM MDCYLTHTND TAFLQENIET 250
    LALELDFWTK NRTVSVSLEG KNYLLNRYYV PYGGPRPESY SKDVELADTL 300
    PEGDREALWA ELKAGAESGW DFSSRWLIGG PNPNSLSGIR TSKLVPVDLN 350
    AFLCQAEELM SNFYSRLGND SQATKYRILR SQRLAALNTV LWDEQTGAWF 400
    DYDLEKKKKN REFYPSNLTP LWAGCFSDPG VADKALKYLE DNRILTYQYG 450
    IPTSLQKTGQ QWDFPNAWAP LQDLVIRGLA KAPLRRAQEV AFQLAQNWIR 500
    TNFDVYSQKS AMYEKYDVSN GGQPGGGGEY EVQEGFGWTN GVVLMLLDRY 550
    GDRLTSGAKL AFLEPHCLAA TLLPSLLLSL LPW 583
    Length:583
    Mass (Da):66,568
    Last modified:September 23, 2008 - v2
    Checksum:i3EE4D312B82185F9
    GO
    Isoform 2 (identifier: O43280-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         175-206: WDSYWVMEGLLLSEMAETVKGMLQNFLDLVKT → C

    Note: No experimental confirmation available.

    Show »
    Length:552
    Mass (Da):62,941
    Checksum:i09B87A62D49F49DF
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti539 – 5402TN → DE in BAA24381. (PubMed:9427547)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti389 – 3891T → A.
    Corresponds to variant rs2276065 [ dbSNP | Ensembl ].
    VAR_049205
    Natural varianti449 – 4491Y → H.
    Corresponds to variant rs11827611 [ dbSNP | Ensembl ].
    VAR_049206
    Natural varianti486 – 4861R → W.
    Corresponds to variant rs2276064 [ dbSNP | Ensembl ].
    VAR_049207
    Natural varianti558 – 5581A → P.
    Corresponds to variant rs6589671 [ dbSNP | Ensembl ].
    VAR_049208
    Natural varianti561 – 5611A → P.
    Corresponds to variant rs6589670 [ dbSNP | Ensembl ].
    VAR_061191

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei175 – 20632WDSYW…DLVKT → C in isoform 2. 1 PublicationVSP_035440Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB000824 mRNA. Translation: BAA24381.1.
    AK223140 mRNA. Translation: BAD96860.1.
    AK223143 mRNA. Translation: BAD96863.1.
    CH471065 Genomic DNA. Translation: EAW67409.1.
    BC109206 mRNA. Translation: AAI09207.1.
    PIRiJC6504.
    RefSeqiNP_009111.2. NM_007180.2. [O43280-1]
    XP_005277735.1. XM_005277678.1. [O43280-2]
    UniGeneiHs.129712.

    Genome annotation databases

    EnsembliENST00000264029; ENSP00000264029; ENSG00000118094.
    GeneIDi11181.
    KEGGihsa:11181.
    UCSCiuc001pty.1. human. [O43280-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Wikipedia

    Trehalase entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB000824 mRNA. Translation: BAA24381.1 .
    AK223140 mRNA. Translation: BAD96860.1 .
    AK223143 mRNA. Translation: BAD96863.1 .
    CH471065 Genomic DNA. Translation: EAW67409.1 .
    BC109206 mRNA. Translation: AAI09207.1 .
    PIRi JC6504.
    RefSeqi NP_009111.2. NM_007180.2. [O43280-1 ]
    XP_005277735.1. XM_005277678.1. [O43280-2 ]
    UniGenei Hs.129712.

    3D structure databases

    ProteinModelPortali O43280.
    SMRi O43280. Positions 36-548.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000264029.

    Chemistry

    BindingDBi O43280.
    ChEMBLi CHEMBL3087.

    Protein family/group databases

    CAZyi GH37. Glycoside Hydrolase Family 37.

    PTM databases

    PhosphoSitei O43280.

    Proteomic databases

    PaxDbi O43280.
    PRIDEi O43280.

    Protocols and materials databases

    DNASUi 11181.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264029 ; ENSP00000264029 ; ENSG00000118094 .
    GeneIDi 11181.
    KEGGi hsa:11181.
    UCSCi uc001pty.1. human. [O43280-1 ]

    Organism-specific databases

    CTDi 11181.
    GeneCardsi GC11M118528.
    H-InvDB HIX0010188.
    HGNCi HGNC:12266. TREH.
    HPAi HPA039913.
    MIMi 275360. gene.
    neXtProti NX_O43280.
    Orphaneti 103909. Diarrhea-vomiting due to trehalase deficiency.
    PharmGKBi PA36946.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1626.
    HOGENOMi HOG000215465.
    HOVERGENi HBG014956.
    InParanoidi O43280.
    KOi K01194.
    PhylomeDBi O43280.
    TreeFami TF314239.

    Enzyme and pathway databases

    Reactomei REACT_9472. Digestion of dietary carbohydrate.

    Miscellaneous databases

    GenomeRNAii 11181.
    NextBioi 42547.
    PROi O43280.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O43280.
    Bgeei O43280.
    CleanExi HS_TREH.
    Genevestigatori O43280.

    Family and domain databases

    InterProi IPR008928. 6-hairpin_glycosidase-like.
    IPR001661. Glyco_hydro_37.
    IPR018232. Glyco_hydro_37_CS.
    [Graphical view ]
    PANTHERi PTHR23403. PTHR23403. 1 hit.
    Pfami PF01204. Trehalase. 1 hit.
    [Graphical view ]
    PRINTSi PR00744. GLHYDRLASE37.
    SUPFAMi SSF48208. SSF48208. 1 hit.
    PROSITEi PS00927. TREHALASE_1. 1 hit.
    PS00928. TREHALASE_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning, sequencing and expression of cDNA encoding human trehalase."
      Ishihara R., Taketani S., Sasai-Takedatsu M., Kino M., Tokunaga R., Kobayashi Y.
      Gene 202:69-74(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Kidney.
    2. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Kidney.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    5. "Human trehalase: characterization, localization, and its increase in urine by renal proximal tubular damage."
      Sasai-Takedatsu M., Taketani S., Nagata N., Furukawa T., Tokunaga R., Kojima T., Kobayashi Y.
      Nephron 73:179-185(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL PROTEIN SEQUENCE.

    Entry informationi

    Entry nameiTREA_HUMAN
    AccessioniPrimary (citable) accession number: O43280
    Secondary accession number(s): Q32MB9, Q53FY8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: September 23, 2008
    Last modified: October 1, 2014
    This is version 124 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Glycosyl hydrolases
      Classification of glycosyl hydrolase families and list of entries
    2. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3