Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trehalase

Gene

TREH

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose.

Catalytic activityi

Alpha,alpha-trehalose + H2O = beta-D-glucose + alpha-D-glucose.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei168SubstrateBy similarity1
Binding sitei212SubstrateBy similarity1
Binding sitei319Substrate; via carbonyl oxygenBy similarity1
Active sitei321Proton donor/acceptorBy similarity1
Active sitei514Proton donor/acceptorBy similarity1
Binding sitei529SubstrateBy similarity1

GO - Molecular functioni

  • alpha,alpha-trehalase activity Source: UniProtKB

GO - Biological processi

  • animal organ morphogenesis Source: Ensembl
  • trehalose catabolic process Source: ProtInc
  • trehalose metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Enzyme and pathway databases

BioCyciZFISH:HS04189-MONOMER.
ReactomeiR-HSA-189085. Digestion of dietary carbohydrate.

Protein family/group databases

CAZyiGH37. Glycoside Hydrolase Family 37.

Names & Taxonomyi

Protein namesi
Recommended name:
Trehalase (EC:3.2.1.28)
Alternative name(s):
Alpha,alpha-trehalase
Alpha,alpha-trehalose glucohydrolase
Gene namesi
Name:TREH
Synonyms:TREA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:12266. TREH.

Subcellular locationi

GO - Cellular componenti

  • anchored component of plasma membrane Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Deficiency of TREH results in isolated trehalose intolerance that causes gastrointestinal symptoms after ingestion of edible mushrooms.

Organism-specific databases

DisGeNETi11181.
MalaCardsiTREH.
OpenTargetsiENSG00000118094.
Orphaneti103909. Diarrhea-vomiting due to trehalase deficiency.
PharmGKBiPA36946.

Chemistry databases

ChEMBLiCHEMBL3087.

Polymorphism and mutation databases

BioMutaiTREH.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000001205124 – 556TrehalaseAdd BLAST533
PropeptideiPRO_0000012052557 – 583Removed in mature formBy similarityAdd BLAST27

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi78N-linked (GlcNAc...)Sequence analysis1
Glycosylationi239N-linked (GlcNAc...)Sequence analysis1
Glycosylationi261N-linked (GlcNAc...)Sequence analysis1
Glycosylationi369N-linked (GlcNAc...)Sequence analysis1
Lipidationi556GPI-anchor amidated serineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PaxDbiO43280.
PeptideAtlasiO43280.
PRIDEiO43280.

PTM databases

iPTMnetiO43280.
PhosphoSitePlusiO43280.

Expressioni

Gene expression databases

BgeeiENSG00000118094.
CleanExiHS_TREH.
ExpressionAtlasiO43280. baseline and differential.
GenevisibleiO43280. HS.

Organism-specific databases

HPAiHPA039913.
HPA042045.

Interactioni

Subunit structurei

Homodimer; disulfide-linked.By similarity

Protein-protein interaction databases

BioGridi116351. 1 interactor.
STRINGi9606.ENSP00000264029.

Chemistry databases

BindingDBiO43280.

Structurei

3D structure databases

ProteinModelPortaliO43280.
SMRiO43280.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni175 – 176Substrate bindingBy similarity2
Regioni221 – 223Substrate bindingBy similarity3
Regioni286 – 288Substrate bindingBy similarity3

Sequence similaritiesi

Belongs to the glycosyl hydrolase 37 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG0602. Eukaryota.
COG1626. LUCA.
GeneTreeiENSGT00390000006949.
HOGENOMiHOG000215465.
HOVERGENiHBG014956.
InParanoidiO43280.
KOiK01194.
OMAiWAGQLHQ.
OrthoDBiEOG091G0341.
PhylomeDBiO43280.
TreeFamiTF314239.

Family and domain databases

InterProiIPR008928. 6-hairpin_glycosidase-like.
IPR001661. Glyco_hydro_37.
IPR018232. Glyco_hydro_37_CS.
[Graphical view]
PANTHERiPTHR23403. PTHR23403. 1 hit.
PfamiPF01204. Trehalase. 1 hit.
[Graphical view]
PRINTSiPR00744. GLHYDRLASE37.
SUPFAMiSSF48208. SSF48208. 1 hit.
PROSITEiPS00927. TREHALASE_1. 1 hit.
PS00928. TREHALASE_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43280-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPGRTWELCL LLLLGLGLGS QEALPPPCES EIYCHGELLN QVQMAKLYQD
60 70 80 90 100
DKQFVDMPLS IAPEQVLQTF TELSRDHNHS IPREQLQAFV HEHFQAKGQE
110 120 130 140 150
LQPWTPADWK DSPQFLQKIS DAKLRAWAGQ LHQLWKKLGK KMKPEVLSHP
160 170 180 190 200
ERFSLIYSEH PFIVPGGRFV EFYYWDSYWV MEGLLLSEMA ETVKGMLQNF
210 220 230 240 250
LDLVKTYGHV PNGGRVYYLQ RSQPPLLTLM MDCYLTHTND TAFLQENIET
260 270 280 290 300
LALELDFWTK NRTVSVSLEG KNYLLNRYYV PYGGPRPESY SKDVELADTL
310 320 330 340 350
PEGDREALWA ELKAGAESGW DFSSRWLIGG PNPNSLSGIR TSKLVPVDLN
360 370 380 390 400
AFLCQAEELM SNFYSRLGND SQATKYRILR SQRLAALNTV LWDEQTGAWF
410 420 430 440 450
DYDLEKKKKN REFYPSNLTP LWAGCFSDPG VADKALKYLE DNRILTYQYG
460 470 480 490 500
IPTSLQKTGQ QWDFPNAWAP LQDLVIRGLA KAPLRRAQEV AFQLAQNWIR
510 520 530 540 550
TNFDVYSQKS AMYEKYDVSN GGQPGGGGEY EVQEGFGWTN GVVLMLLDRY
560 570 580
GDRLTSGAKL AFLEPHCLAA TLLPSLLLSL LPW
Length:583
Mass (Da):66,568
Last modified:September 23, 2008 - v2
Checksum:i3EE4D312B82185F9
GO
Isoform 2 (identifier: O43280-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-206: WDSYWVMEGLLLSEMAETVKGMLQNFLDLVKT → C

Note: No experimental confirmation available.
Show »
Length:552
Mass (Da):62,941
Checksum:i09B87A62D49F49DF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti539 – 540TN → DE in BAA24381 (PubMed:9427547).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049205389T → A.Corresponds to variant rs2276065dbSNPEnsembl.1
Natural variantiVAR_049206449Y → H.Corresponds to variant rs11827611dbSNPEnsembl.1
Natural variantiVAR_049207486R → W.Corresponds to variant rs2276064dbSNPEnsembl.1
Natural variantiVAR_049208558A → P.Corresponds to variant rs6589671dbSNPEnsembl.1
Natural variantiVAR_061191561A → P.Corresponds to variant rs6589670dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_035440175 – 206WDSYW…DLVKT → C in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000824 mRNA. Translation: BAA24381.1.
AK223140 mRNA. Translation: BAD96860.1.
AK223143 mRNA. Translation: BAD96863.1.
CH471065 Genomic DNA. Translation: EAW67409.1.
BC109206 mRNA. Translation: AAI09207.1.
CCDSiCCDS73401.1. [O43280-2]
CCDS73402.1. [O43280-1]
PIRiJC6504.
RefSeqiNP_001287994.1. NM_001301065.1. [O43280-2]
NP_009111.2. NM_007180.2. [O43280-1]
UniGeneiHs.129712.

Genome annotation databases

EnsembliENST00000264029; ENSP00000264029; ENSG00000118094. [O43280-1]
ENST00000397925; ENSP00000381020; ENSG00000118094. [O43280-2]
GeneIDi11181.
KEGGihsa:11181.
UCSCiuc031ygn.2. human. [O43280-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Trehalase entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000824 mRNA. Translation: BAA24381.1.
AK223140 mRNA. Translation: BAD96860.1.
AK223143 mRNA. Translation: BAD96863.1.
CH471065 Genomic DNA. Translation: EAW67409.1.
BC109206 mRNA. Translation: AAI09207.1.
CCDSiCCDS73401.1. [O43280-2]
CCDS73402.1. [O43280-1]
PIRiJC6504.
RefSeqiNP_001287994.1. NM_001301065.1. [O43280-2]
NP_009111.2. NM_007180.2. [O43280-1]
UniGeneiHs.129712.

3D structure databases

ProteinModelPortaliO43280.
SMRiO43280.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116351. 1 interactor.
STRINGi9606.ENSP00000264029.

Chemistry databases

BindingDBiO43280.
ChEMBLiCHEMBL3087.

Protein family/group databases

CAZyiGH37. Glycoside Hydrolase Family 37.

PTM databases

iPTMnetiO43280.
PhosphoSitePlusiO43280.

Polymorphism and mutation databases

BioMutaiTREH.

Proteomic databases

PaxDbiO43280.
PeptideAtlasiO43280.
PRIDEiO43280.

Protocols and materials databases

DNASUi11181.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264029; ENSP00000264029; ENSG00000118094. [O43280-1]
ENST00000397925; ENSP00000381020; ENSG00000118094. [O43280-2]
GeneIDi11181.
KEGGihsa:11181.
UCSCiuc031ygn.2. human. [O43280-1]

Organism-specific databases

CTDi11181.
DisGeNETi11181.
GeneCardsiTREH.
H-InvDBHIX0010188.
HGNCiHGNC:12266. TREH.
HPAiHPA039913.
HPA042045.
MalaCardsiTREH.
MIMi275360. gene.
neXtProtiNX_O43280.
OpenTargetsiENSG00000118094.
Orphaneti103909. Diarrhea-vomiting due to trehalase deficiency.
PharmGKBiPA36946.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0602. Eukaryota.
COG1626. LUCA.
GeneTreeiENSGT00390000006949.
HOGENOMiHOG000215465.
HOVERGENiHBG014956.
InParanoidiO43280.
KOiK01194.
OMAiWAGQLHQ.
OrthoDBiEOG091G0341.
PhylomeDBiO43280.
TreeFamiTF314239.

Enzyme and pathway databases

BioCyciZFISH:HS04189-MONOMER.
ReactomeiR-HSA-189085. Digestion of dietary carbohydrate.

Miscellaneous databases

GenomeRNAii11181.
PROiO43280.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000118094.
CleanExiHS_TREH.
ExpressionAtlasiO43280. baseline and differential.
GenevisibleiO43280. HS.

Family and domain databases

InterProiIPR008928. 6-hairpin_glycosidase-like.
IPR001661. Glyco_hydro_37.
IPR018232. Glyco_hydro_37_CS.
[Graphical view]
PANTHERiPTHR23403. PTHR23403. 1 hit.
PfamiPF01204. Trehalase. 1 hit.
[Graphical view]
PRINTSiPR00744. GLHYDRLASE37.
SUPFAMiSSF48208. SSF48208. 1 hit.
PROSITEiPS00927. TREHALASE_1. 1 hit.
PS00928. TREHALASE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTREA_HUMAN
AccessioniPrimary (citable) accession number: O43280
Secondary accession number(s): Q32MB9, Q53FY8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 23, 2008
Last modified: November 2, 2016
This is version 142 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.