O43280 (TREA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Trehalase EC=3.2.1.28 Alternative name(s): Alpha,alpha-trehalase Alpha,alpha-trehalose glucohydrolase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 583 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose. |
| Catalytic activity | Alpha,alpha-trehalose + H2O = beta-D-glucose + alpha-D-glucose. |
| Subunit structure | Homodimer; disulfide-linked By similarity. |
| Subcellular location | Cell membrane; Lipid-anchor › GPI-anchor By similarity. |
| Involvement in disease | Deficiency of TREH results in isolated trehalose intolerance that causes gastrointestinal symptoms after ingestion of edible mushrooms. |
| Sequence similarities | Belongs to the glycosyl hydrolase 37 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Molecular function | Glycosidase Hydrolase |
| PTM | Disulfide bond GPI-anchor Glycoprotein Lipoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | polysaccharide digestion Traceable author statement. Source: Reactome small molecule metabolic processTraceable author statement. Source: Reactome trehalose catabolic processTraceable author statement Ref.1. Source: ProtInc |
| Cellular_component | anchored to plasma membrane Traceable author statement Ref.5. Source: UniProtKB |
| Molecular_function | alpha,alpha-trehalase activity Inferred from direct assay Ref.5. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43280-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43280-2) The sequence of this isoform differs from the canonical sequence as follows: 175-206: WDSYWVMEGLLLSEMAETVKGMLQNFLDLVKT → C | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | ||||||
| Chain | 24 – 556 | 533 | Trehalase | PRO_0000012051 | |||||
| Propeptide | 557 – 583 | 27 | Removed in mature form By similarity | PRO_0000012052 | |||||
Amino acid modifications | |||||||||
| Lipidation | 556 | 1 | GPI-anchor amidated serine Potential | ||||||
| Glycosylation | 78 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 239 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 261 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 369 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 175 – 206 | 32 | WDSYW…DLVKT → C in isoform 2. | VSP_035440 | |||||
| Natural variant | 389 | 1 | T → A. Corresponds to variant rs2276065 [ dbSNP | Ensembl ]. | VAR_049205 | |||||
| Natural variant | 449 | 1 | Y → H. Corresponds to variant rs11827611 [ dbSNP | Ensembl ]. | VAR_049206 | |||||
| Natural variant | 486 | 1 | R → W. Corresponds to variant rs2276064 [ dbSNP | Ensembl ]. | VAR_049207 | |||||
| Natural variant | 558 | 1 | A → P. Corresponds to variant rs6589671 [ dbSNP | Ensembl ]. | VAR_049208 | |||||
| Natural variant | 561 | 1 | A → P. Corresponds to variant rs6589670 [ dbSNP | Ensembl ]. | VAR_061191 | |||||
Experimental info | |||||||||
| Sequence conflict | 539 – 540 | 2 | TN → DE in BAA24381. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning, sequencing and expression of cDNA encoding human trehalase." Ishihara R., Taketani S., Sasai-Takedatsu M., Kino M., Tokunaga R., Kobayashi Y. Gene 202:69-74(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Kidney. |
| [2] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [5] | "Human trehalase: characterization, localization, and its increase in urine by renal proximal tubular damage." Sasai-Takedatsu M., Taketani S., Nagata N., Furukawa T., Tokunaga R., Kojima T., Kobayashi Y. Nephron 73:179-185(1996) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Trehalase entry |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB000824 mRNA. Translation: BAA24381.1. AK223140 mRNA. Translation: BAD96860.1. AK223143 mRNA. Translation: BAD96863.1. CH471065 Genomic DNA. Translation: EAW67409.1. BC109206 mRNA. Translation: AAI09207.1. |
| IPI | IPI00011650. IPI00656107. |
| PIR | JC6504. |
| RefSeq | NP_009111.2. NM_007180.2. |
| UniGene | Hs.129712. |
3D structure databases | |
| ProteinModelPortal | O43280. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000264029. |
Protein family/group databases | |
| CAZy | GH37. Glycoside Hydrolase Family 37. |
PTM databases | |
| PhosphoSite | O43280. |
Proteomic databases | |
| PaxDb | O43280. |
| PRIDE | O43280. |
Protocols and materials databases | |
| DNASU | 11181. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264029; ENSP00000264029; ENSG00000118094. |
| GeneID | 11181. |
| KEGG | hsa:11181. |
| UCSC | uc001pty.1. human. |
Organism-specific databases | |
| CTD | 11181. |
| GeneCards | GC11M118528. |
| H-InvDB | HIX0010188. |
| HGNC | HGNC:12266. TREH. |
| HPA | HPA039913. |
| MIM | 275360. gene. |
| neXtProt | NX_O43280. |
| Orphanet | 103909. Diarrhea-vomiting due to trehalase deficiency. |
| PharmGKB | PA36946. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1626. |
| HOGENOM | HOG000215465. |
| HOVERGEN | HBG014956. |
| InParanoid | O43280. |
| KO | K01194. |
| OrthoDB | EOG4R23TH. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| ArrayExpress | O43280. |
| Bgee | O43280. |
| CleanEx | HS_TREH. |
| Genevestigator | O43280. |
| GermOnline | ENSG00000118094. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008928. 6-hairpin_glycosidase-like. IPR001661. Glyco_hydro_37. IPR018232. Glyco_hydro_37_CS. [Graphical view] |
| PANTHER | PTHR23403. PTHR23403. 1 hit. |
| Pfam | PF01204. Trehalase. 1 hit. [Graphical view] |
| PRINTS | PR00744. GLHYDRLASE37. |
| SUPFAM | SSF48208. Glyco_trans_6hp. 1 hit. |
| PROSITE | PS00927. TREHALASE_1. 1 hit. PS00928. TREHALASE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | O43280. |
| ChEMBL | CHEMBL3087. |
| GenomeRNAi | 11181. |
| NextBio | 42547. |
| SOURCE | Search... |
Entry information
| Entry name | TREA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43280 Secondary accession number(s): Q32MB9, Q53FY8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Glycosyl hydrolases Classification of glycosyl hydrolase families and list of entries |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
