Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trehalase

Gene

TREH

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose.

Catalytic activityi

Alpha,alpha-trehalose + H2O = beta-D-glucose + alpha-D-glucose.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei168 – 1681SubstrateBy similarity
Binding sitei212 – 2121SubstrateBy similarity
Binding sitei319 – 3191Substrate; via carbonyl oxygenBy similarity
Active sitei321 – 3211Proton donor/acceptorBy similarity
Active sitei514 – 5141Proton donor/acceptorBy similarity
Binding sitei529 – 5291SubstrateBy similarity

GO - Molecular functioni

  • alpha,alpha-trehalase activity Source: UniProtKB

GO - Biological processi

  • carbohydrate metabolic process Source: Reactome
  • organ morphogenesis Source: Ensembl
  • polysaccharide digestion Source: Reactome
  • small molecule metabolic process Source: Reactome
  • trehalose catabolic process Source: ProtInc
  • trehalose metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Enzyme and pathway databases

ReactomeiREACT_9472. Digestion of dietary carbohydrate.

Protein family/group databases

CAZyiGH37. Glycoside Hydrolase Family 37.

Names & Taxonomyi

Protein namesi
Recommended name:
Trehalase (EC:3.2.1.28)
Alternative name(s):
Alpha,alpha-trehalase
Alpha,alpha-trehalose glucohydrolase
Gene namesi
Name:TREH
Synonyms:TREA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:12266. TREH.

Subcellular locationi

GO - Cellular componenti

  • anchored component of plasma membrane Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Deficiency of TREH results in isolated trehalose intolerance that causes gastrointestinal symptoms after ingestion of edible mushrooms.

Organism-specific databases

Orphaneti103909. Diarrhea-vomiting due to trehalase deficiency.
PharmGKBiPA36946.

Polymorphism and mutation databases

BioMutaiTREH.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence AnalysisAdd
BLAST
Chaini24 – 556533TrehalasePRO_0000012051Add
BLAST
Propeptidei557 – 58327Removed in mature formBy similarityPRO_0000012052Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi78 – 781N-linked (GlcNAc...)Sequence Analysis
Glycosylationi239 – 2391N-linked (GlcNAc...)Sequence Analysis
Glycosylationi261 – 2611N-linked (GlcNAc...)Sequence Analysis
Glycosylationi369 – 3691N-linked (GlcNAc...)Sequence Analysis
Lipidationi556 – 5561GPI-anchor amidated serineSequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PaxDbiO43280.
PRIDEiO43280.

PTM databases

PhosphoSiteiO43280.

Expressioni

Gene expression databases

BgeeiO43280.
CleanExiHS_TREH.
ExpressionAtlasiO43280. baseline and differential.
GenevisibleiO43280. HS.

Organism-specific databases

HPAiHPA039913.

Interactioni

Subunit structurei

Homodimer; disulfide-linked.By similarity

Structurei

3D structure databases

ProteinModelPortaliO43280.
SMRiO43280. Positions 36-548.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni175 – 1762Substrate bindingBy similarity
Regioni221 – 2233Substrate bindingBy similarity
Regioni286 – 2883Substrate bindingBy similarity

Sequence similaritiesi

Belongs to the glycosyl hydrolase 37 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG1626.
GeneTreeiENSGT00390000006949.
HOGENOMiHOG000215465.
HOVERGENiHBG014956.
InParanoidiO43280.
KOiK01194.
PhylomeDBiO43280.
TreeFamiTF314239.

Family and domain databases

InterProiIPR008928. 6-hairpin_glycosidase-like.
IPR001661. Glyco_hydro_37.
IPR018232. Glyco_hydro_37_CS.
[Graphical view]
PANTHERiPTHR23403. PTHR23403. 1 hit.
PfamiPF01204. Trehalase. 1 hit.
[Graphical view]
PRINTSiPR00744. GLHYDRLASE37.
SUPFAMiSSF48208. SSF48208. 1 hit.
PROSITEiPS00927. TREHALASE_1. 1 hit.
PS00928. TREHALASE_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43280-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPGRTWELCL LLLLGLGLGS QEALPPPCES EIYCHGELLN QVQMAKLYQD
60 70 80 90 100
DKQFVDMPLS IAPEQVLQTF TELSRDHNHS IPREQLQAFV HEHFQAKGQE
110 120 130 140 150
LQPWTPADWK DSPQFLQKIS DAKLRAWAGQ LHQLWKKLGK KMKPEVLSHP
160 170 180 190 200
ERFSLIYSEH PFIVPGGRFV EFYYWDSYWV MEGLLLSEMA ETVKGMLQNF
210 220 230 240 250
LDLVKTYGHV PNGGRVYYLQ RSQPPLLTLM MDCYLTHTND TAFLQENIET
260 270 280 290 300
LALELDFWTK NRTVSVSLEG KNYLLNRYYV PYGGPRPESY SKDVELADTL
310 320 330 340 350
PEGDREALWA ELKAGAESGW DFSSRWLIGG PNPNSLSGIR TSKLVPVDLN
360 370 380 390 400
AFLCQAEELM SNFYSRLGND SQATKYRILR SQRLAALNTV LWDEQTGAWF
410 420 430 440 450
DYDLEKKKKN REFYPSNLTP LWAGCFSDPG VADKALKYLE DNRILTYQYG
460 470 480 490 500
IPTSLQKTGQ QWDFPNAWAP LQDLVIRGLA KAPLRRAQEV AFQLAQNWIR
510 520 530 540 550
TNFDVYSQKS AMYEKYDVSN GGQPGGGGEY EVQEGFGWTN GVVLMLLDRY
560 570 580
GDRLTSGAKL AFLEPHCLAA TLLPSLLLSL LPW
Length:583
Mass (Da):66,568
Last modified:September 23, 2008 - v2
Checksum:i3EE4D312B82185F9
GO
Isoform 2 (identifier: O43280-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-206: WDSYWVMEGLLLSEMAETVKGMLQNFLDLVKT → C

Note: No experimental confirmation available.
Show »
Length:552
Mass (Da):62,941
Checksum:i09B87A62D49F49DF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti539 – 5402TN → DE in BAA24381 (PubMed:9427547).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti389 – 3891T → A.
Corresponds to variant rs2276065 [ dbSNP | Ensembl ].
VAR_049205
Natural varianti449 – 4491Y → H.
Corresponds to variant rs11827611 [ dbSNP | Ensembl ].
VAR_049206
Natural varianti486 – 4861R → W.
Corresponds to variant rs2276064 [ dbSNP | Ensembl ].
VAR_049207
Natural varianti558 – 5581A → P.
Corresponds to variant rs6589671 [ dbSNP | Ensembl ].
VAR_049208
Natural varianti561 – 5611A → P.
Corresponds to variant rs6589670 [ dbSNP | Ensembl ].
VAR_061191

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei175 – 20632WDSYW…DLVKT → C in isoform 2. 1 PublicationVSP_035440Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000824 mRNA. Translation: BAA24381.1.
AK223140 mRNA. Translation: BAD96860.1.
AK223143 mRNA. Translation: BAD96863.1.
CH471065 Genomic DNA. Translation: EAW67409.1.
BC109206 mRNA. Translation: AAI09207.1.
CCDSiCCDS73401.1. [O43280-2]
CCDS73402.1. [O43280-1]
PIRiJC6504.
RefSeqiNP_001287994.1. NM_001301065.1. [O43280-2]
NP_009111.2. NM_007180.2. [O43280-1]
UniGeneiHs.129712.

Genome annotation databases

EnsembliENST00000264029; ENSP00000264029; ENSG00000118094. [O43280-1]
ENST00000397925; ENSP00000381020; ENSG00000118094. [O43280-2]
GeneIDi11181.
KEGGihsa:11181.
UCSCiuc001pty.1. human. [O43280-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Trehalase entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000824 mRNA. Translation: BAA24381.1.
AK223140 mRNA. Translation: BAD96860.1.
AK223143 mRNA. Translation: BAD96863.1.
CH471065 Genomic DNA. Translation: EAW67409.1.
BC109206 mRNA. Translation: AAI09207.1.
CCDSiCCDS73401.1. [O43280-2]
CCDS73402.1. [O43280-1]
PIRiJC6504.
RefSeqiNP_001287994.1. NM_001301065.1. [O43280-2]
NP_009111.2. NM_007180.2. [O43280-1]
UniGeneiHs.129712.

3D structure databases

ProteinModelPortaliO43280.
SMRiO43280. Positions 36-548.
ModBaseiSearch...
MobiDBiSearch...

Chemistry

BindingDBiO43280.
ChEMBLiCHEMBL3087.

Protein family/group databases

CAZyiGH37. Glycoside Hydrolase Family 37.

PTM databases

PhosphoSiteiO43280.

Polymorphism and mutation databases

BioMutaiTREH.

Proteomic databases

PaxDbiO43280.
PRIDEiO43280.

Protocols and materials databases

DNASUi11181.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264029; ENSP00000264029; ENSG00000118094. [O43280-1]
ENST00000397925; ENSP00000381020; ENSG00000118094. [O43280-2]
GeneIDi11181.
KEGGihsa:11181.
UCSCiuc001pty.1. human. [O43280-1]

Organism-specific databases

CTDi11181.
GeneCardsiGC11M118528.
H-InvDBHIX0010188.
HGNCiHGNC:12266. TREH.
HPAiHPA039913.
MIMi275360. gene.
neXtProtiNX_O43280.
Orphaneti103909. Diarrhea-vomiting due to trehalase deficiency.
PharmGKBiPA36946.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG1626.
GeneTreeiENSGT00390000006949.
HOGENOMiHOG000215465.
HOVERGENiHBG014956.
InParanoidiO43280.
KOiK01194.
PhylomeDBiO43280.
TreeFamiTF314239.

Enzyme and pathway databases

ReactomeiREACT_9472. Digestion of dietary carbohydrate.

Miscellaneous databases

GenomeRNAii11181.
NextBioi42547.
PROiO43280.
SOURCEiSearch...

Gene expression databases

BgeeiO43280.
CleanExiHS_TREH.
ExpressionAtlasiO43280. baseline and differential.
GenevisibleiO43280. HS.

Family and domain databases

InterProiIPR008928. 6-hairpin_glycosidase-like.
IPR001661. Glyco_hydro_37.
IPR018232. Glyco_hydro_37_CS.
[Graphical view]
PANTHERiPTHR23403. PTHR23403. 1 hit.
PfamiPF01204. Trehalase. 1 hit.
[Graphical view]
PRINTSiPR00744. GLHYDRLASE37.
SUPFAMiSSF48208. SSF48208. 1 hit.
PROSITEiPS00927. TREHALASE_1. 1 hit.
PS00928. TREHALASE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning, sequencing and expression of cDNA encoding human trehalase."
    Ishihara R., Taketani S., Sasai-Takedatsu M., Kino M., Tokunaga R., Kobayashi Y.
    Gene 202:69-74(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Kidney.
  2. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  5. "Human trehalase: characterization, localization, and its increase in urine by renal proximal tubular damage."
    Sasai-Takedatsu M., Taketani S., Nagata N., Furukawa T., Tokunaga R., Kojima T., Kobayashi Y.
    Nephron 73:179-185(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL PROTEIN SEQUENCE.

Entry informationi

Entry nameiTREA_HUMAN
AccessioniPrimary (citable) accession number: O43280
Secondary accession number(s): Q32MB9, Q53FY8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 23, 2008
Last modified: June 24, 2015
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.