Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O43280 (TREA_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 121. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Trehalase

EC=3.2.1.28
Alternative name(s):
Alpha,alpha-trehalase
Alpha,alpha-trehalose glucohydrolase
Gene names
Name:TREH
Synonyms:TREA
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length583 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose.

Catalytic activity

Alpha,alpha-trehalose + H2O = beta-D-glucose + alpha-D-glucose.

Subunit structure

Homodimer; disulfide-linked By similarity.

Subcellular location

Cell membrane; Lipid-anchorGPI-anchor By similarity.

Involvement in disease

Deficiency of TREH results in isolated trehalose intolerance that causes gastrointestinal symptoms after ingestion of edible mushrooms.

Sequence similarities

Belongs to the glycosyl hydrolase 37 family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O43280-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O43280-2)

The sequence of this isoform differs from the canonical sequence as follows:
     175-206: WDSYWVMEGLLLSEMAETVKGMLQNFLDLVKT → C
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2323 Potential
Chain24 – 556533Trehalase
PRO_0000012051
Propeptide557 – 58327Removed in mature form By similarity
PRO_0000012052

Regions

Region175 – 1762Substrate binding By similarity
Region221 – 2233Substrate binding By similarity
Region286 – 2883Substrate binding By similarity

Sites

Active site3211Proton donor/acceptor By similarity
Active site5141Proton donor/acceptor By similarity
Binding site1681Substrate By similarity
Binding site2121Substrate By similarity
Binding site3191Substrate; via carbonyl oxygen By similarity
Binding site5291Substrate By similarity

Amino acid modifications

Lipidation5561GPI-anchor amidated serine Potential
Glycosylation781N-linked (GlcNAc...) Potential
Glycosylation2391N-linked (GlcNAc...) Potential
Glycosylation2611N-linked (GlcNAc...) Potential
Glycosylation3691N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence175 – 20632WDSYW…DLVKT → C in isoform 2.
VSP_035440
Natural variant3891T → A.
Corresponds to variant rs2276065 [ dbSNP | Ensembl ].
VAR_049205
Natural variant4491Y → H.
Corresponds to variant rs11827611 [ dbSNP | Ensembl ].
VAR_049206
Natural variant4861R → W.
Corresponds to variant rs2276064 [ dbSNP | Ensembl ].
VAR_049207
Natural variant5581A → P.
Corresponds to variant rs6589671 [ dbSNP | Ensembl ].
VAR_049208
Natural variant5611A → P.
Corresponds to variant rs6589670 [ dbSNP | Ensembl ].
VAR_061191

Experimental info

Sequence conflict539 – 5402TN → DE in BAA24381. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 23, 2008. Version 2.
Checksum: 3EE4D312B82185F9

FASTA58366,568
        10         20         30         40         50         60 
MPGRTWELCL LLLLGLGLGS QEALPPPCES EIYCHGELLN QVQMAKLYQD DKQFVDMPLS 

        70         80         90        100        110        120 
IAPEQVLQTF TELSRDHNHS IPREQLQAFV HEHFQAKGQE LQPWTPADWK DSPQFLQKIS 

       130        140        150        160        170        180 
DAKLRAWAGQ LHQLWKKLGK KMKPEVLSHP ERFSLIYSEH PFIVPGGRFV EFYYWDSYWV 

       190        200        210        220        230        240 
MEGLLLSEMA ETVKGMLQNF LDLVKTYGHV PNGGRVYYLQ RSQPPLLTLM MDCYLTHTND 

       250        260        270        280        290        300 
TAFLQENIET LALELDFWTK NRTVSVSLEG KNYLLNRYYV PYGGPRPESY SKDVELADTL 

       310        320        330        340        350        360 
PEGDREALWA ELKAGAESGW DFSSRWLIGG PNPNSLSGIR TSKLVPVDLN AFLCQAEELM 

       370        380        390        400        410        420 
SNFYSRLGND SQATKYRILR SQRLAALNTV LWDEQTGAWF DYDLEKKKKN REFYPSNLTP 

       430        440        450        460        470        480 
LWAGCFSDPG VADKALKYLE DNRILTYQYG IPTSLQKTGQ QWDFPNAWAP LQDLVIRGLA 

       490        500        510        520        530        540 
KAPLRRAQEV AFQLAQNWIR TNFDVYSQKS AMYEKYDVSN GGQPGGGGEY EVQEGFGWTN 

       550        560        570        580 
GVVLMLLDRY GDRLTSGAKL AFLEPHCLAA TLLPSLLLSL LPW 

« Hide

Isoform 2 [UniParc].

Checksum: 09B87A62D49F49DF
Show »

FASTA55262,941

References

« Hide 'large scale' references
[1]"Molecular cloning, sequencing and expression of cDNA encoding human trehalase."
Ishihara R., Taketani S., Sasai-Takedatsu M., Kino M., Tokunaga R., Kobayashi Y.
Gene 202:69-74(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Kidney.
[2]Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Kidney.
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[5]"Human trehalase: characterization, localization, and its increase in urine by renal proximal tubular damage."
Sasai-Takedatsu M., Taketani S., Nagata N., Furukawa T., Tokunaga R., Kojima T., Kobayashi Y.
Nephron 73:179-185(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: PARTIAL PROTEIN SEQUENCE.
+Additional computationally mapped references.

Web resources

Wikipedia

Trehalase entry

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB000824 mRNA. Translation: BAA24381.1.
AK223140 mRNA. Translation: BAD96860.1.
AK223143 mRNA. Translation: BAD96863.1.
CH471065 Genomic DNA. Translation: EAW67409.1.
BC109206 mRNA. Translation: AAI09207.1.
PIRJC6504.
RefSeqNP_009111.2. NM_007180.2.
XP_005277735.1. XM_005277678.1.
UniGeneHs.129712.

3D structure databases

ProteinModelPortalO43280.
SMRO43280. Positions 36-548.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000264029.

Chemistry

BindingDBO43280.
ChEMBLCHEMBL3087.

Protein family/group databases

CAZyGH37. Glycoside Hydrolase Family 37.

PTM databases

PhosphoSiteO43280.

Proteomic databases

PaxDbO43280.
PRIDEO43280.

Protocols and materials databases

DNASU11181.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000264029; ENSP00000264029; ENSG00000118094.
GeneID11181.
KEGGhsa:11181.
UCSCuc001pty.1. human. [O43280-1]

Organism-specific databases

CTD11181.
GeneCardsGC11M118528.
H-InvDBHIX0010188.
HGNCHGNC:12266. TREH.
HPAHPA039913.
MIM275360. gene.
neXtProtNX_O43280.
Orphanet103909. Diarrhea-vomiting due to trehalase deficiency.
PharmGKBPA36946.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1626.
HOGENOMHOG000215465.
HOVERGENHBG014956.
InParanoidO43280.
KOK01194.
PhylomeDBO43280.
TreeFamTF314239.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.

Gene expression databases

ArrayExpressO43280.
BgeeO43280.
CleanExHS_TREH.
GenevestigatorO43280.

Family and domain databases

InterProIPR008928. 6-hairpin_glycosidase-like.
IPR001661. Glyco_hydro_37.
IPR018232. Glyco_hydro_37_CS.
[Graphical view]
PANTHERPTHR23403. PTHR23403. 1 hit.
PfamPF01204. Trehalase. 1 hit.
[Graphical view]
PRINTSPR00744. GLHYDRLASE37.
SUPFAMSSF48208. SSF48208. 1 hit.
PROSITEPS00927. TREHALASE_1. 1 hit.
PS00928. TREHALASE_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi11181.
NextBio42547.
PROO43280.
SOURCESearch...

Entry information

Entry nameTREA_HUMAN
AccessionPrimary (citable) accession number: O43280
Secondary accession number(s): Q32MB9, Q53FY8
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 23, 2008
Last modified: April 16, 2014
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM

Glycosyl hydrolases

Classification of glycosyl hydrolase families and list of entries