Reviewed,
UniProtKB/Swiss-Prot O43251 (RBM9_HUMAN)
Last modified
July 7, 2009.
Version 91.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: RNA-binding protein 9 Alternative name(s): RNA-binding motif protein 9 Fox-1 homolog B Hexaribonucleotide-binding protein 2 Repressor of tamoxifen transcriptional activity | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 390 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis By similarity. RNA-binding protein that seems to act as a coregulatory factor of ER-alpha. |
| Subunit structure | Interacts with ER-alpha N-terminal activation domain. |
| Subcellular location | |
| Sequence similarities | Contains 1 RRM (RNA recognition motif) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATXN1 | P54253 | 1 | EBI-746056,EBI-930964 | |
| FOX1 | Q9NWB1 | 1 | EBI-746056,EBI-945906 | |
| QKI | Q96PU8 | 1 | EBI-746056,EBI-945792 |
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: O43251-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: O43251-2) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT 94-94: T → TQ | |||||||||
| Isoform 3 (identifier: O43251-3) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT 143-160: Missing. 261-265: SLPLV → I | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform 4 (identifier: O43251-4) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT 311-390: VYQDGFYGAD...RGGYSRFAPY → DMQPTDMHSL...TADLPPTEVT | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform 5 (identifier: O43251-5) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT 261-265: SLPLV → I | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform 6 (identifier: O43251-6) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGM | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 8 | 1 | H → Q in BAB70875. Ref.4 | ||||||
| Isoform 7 (identifier: O43251-7) The sequence of this isoform differs from the canonical sequence as follows: 261-265: SLPLV → I 323-390: GGYAAYRYAQ...RGGYSRFAPY → IESANCFRSN...TADLPPTEVT | |||||||||
| Isoform 8 (identifier: O43251-8) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGM 94-94: T → TQ | |||||||||
| Isoform 9 (identifier: O43251-9) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT 94-94: T → TQ 261-265: SLPLV → I 311-390: VYQDGFYGAD...RGGYSRFAPY → DMQPTDMHSL...TADLPPTEVT | |||||||||
| Isoform 10 (identifier: O43251-10) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 390 | 390 | RNA-binding protein 9 | PRO_0000081766 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Domain | 121 – 197 | 77 | RRM | |||||||||||||||||||||
| Compositional bias | 273 – 377 | 105 | Ala-rich | |||||||||||||||||||||
Sites | ||||||||||||||||||||||||
| Site | 122 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 130 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 131 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 155 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 160 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 164 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 188 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 198 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 1 – 18 | 18 | MQNEP…PARDS → MEKKKMVT in isoform 2, isoform 3, isoform 4, isoform 5, isoform 9 and isoform 10. | VSP_007180 | ||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MAEGAQPHQPPQLGPGAAAR GMKRESELELPVPGAGGDGA DPGLSKRPRTEEAAADGGGG M in isoform 6 and isoform 8. | VSP_030889 | ||||||||||||||||||||
| Alternative sequence | 94 | 1 | T → TQ in isoform 2, isoform 8 and isoform 9. | VSP_030890 | ||||||||||||||||||||
| Alternative sequence | 143 – 160 | 18 | Missing in isoform 3. | VSP_007181 | ||||||||||||||||||||
| Alternative sequence | 261 – 265 | 5 | SLPLV → I in isoform 3, isoform 5, isoform 7 and isoform 9. | VSP_007182 | ||||||||||||||||||||
| Alternative sequence | 311 – 390 | 80 | VYQDG…RFAPY → DMQPTDMHSLLLQPQPPLLQ PLQPLTVTVMAGCTQPTPTM PLPLPLAMELALWRVYTEVA TADLPPTEVT in isoform 4 and isoform 9. | VSP_007183 | ||||||||||||||||||||
| Alternative sequence | 323 – 390 | 68 | GGYAA…RFAPY → IESANCFRSNRVDMQPTDMH SLLLQPQPPLLQPLQPLTVT VMAGCTQPTPTMPLPLPLAM ELALWRVYTEVATADLPPTE VT in isoform 7. | VSP_030891 | ||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||
| Sequence conflict | 116 | 1 | S → G in AAX84843. Ref.6 | |||||||||||||||||||||
| Sequence conflict | 231 | 1 | S → F in BAB70875. Ref.4 | |||||||||||||||||||||
| Sequence conflict | 346 | 1 | A → V in AAH13115. Ref.8 | |||||||||||||||||||||
| Sequence conflict | 350 | 1 | S → G in BAB70875. Ref.4 | |||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Beta strand | 122 – 127 | 6 | ||||||||||||||||||||||
| Helix | 134 – 140 | 7 | ||||||||||||||||||||||
| Helix | 141 – 143 | 3 | ||||||||||||||||||||||
| Beta strand | 147 – 153 | 7 | ||||||||||||||||||||||
| Turn | 156 – 159 | 4 | ||||||||||||||||||||||
| Beta strand | 162 – 168 | 7 | ||||||||||||||||||||||
| Helix | 170 – 180 | 11 | ||||||||||||||||||||||
| Beta strand | 191 – 194 | 4 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A negative coregulator for the human ER." Norris J.D., Fan D., Sherk A., McDonnell D.P. Mol. Endocrinol. 16:459-468(2002) [PubMed: 11875103] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. |
| [2] | Chen W., Winkelmann J.C. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 10). |
| [3] | "A novel isoform of RNA binding motif protein 9." Yang G., Huang S.C., Benz E.J. Jr. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [4] | "Reevaluating human gene annotation: a second-generation analysis of chromosome 22." Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I. Genome Res. 13:27-36(2003) [PubMed: 12529303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9). Tissue: Placenta. |
| [5] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:RESEARCH84.1-RESEARCH84.11(2004) [PubMed: 15461802] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 6). Tissue: Brain. |
| [7] | Zhou G., Nong W., Li H., Ke R., Shen C., Liang M., Tang Z., Huang B., Lin L., Yang S. Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8). |
| [8] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed: 10591208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 10). Tissue: Adrenal gland and Uterus. |
| [10] | "XRbm9, a new XGld2-interacting protein, enhances translation in Xenopus oocytes." Papin C. Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3-390 (ISOFORM 7). |
| [11] | "Solution structure of RNA binding domain in RNA binding motif protein 9." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 113-202. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AY072786 mRNA. Translation: AAL67150.1. AF229058 mRNA. Translation: AAL71905.1. AY960684 mRNA. Translation: AAX84843.1. AL009266 mRNA. Translation: CAA15842.1. CR456559 mRNA. Translation: CAG30445.1. AK055213 mRNA. Translation: BAB70875.1. AK291460 mRNA. Translation: BAF84149.1. DQ778625 mRNA. Translation: ABG77459.1. AL079295, AL049748 Genomic DNA. Translation: CAI19059.1. BC013115 mRNA. Translation: AAH13115.1. BC025281 mRNA. Translation: AAH25281.1. AM419009 mRNA. Translation: CAL91352.1. | |||||||||||||
| IPI | IPI00179299. IPI00258168. IPI00258170. IPI00554810. IPI00843981. IPI00844525. IPI00844603. IPI00885127. | ||||||||||||
| RefSeq | NP_001026865.1. NP_001076045.1. NP_001076046.1. NP_001076047.1. NP_001076048.1. NP_055124.1. | ||||||||||||
| UniGene | Hs.282998 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O43251. 8 interactions. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O43251. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000100320. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 23543. | ||||||||||||
| KEGG | hsa:23543. | ||||||||||||
| UCSC | uc003aoh.2. human. uc003aol.2. human. uc003aom.2. human. uc003aon.2. human. uc003aoo.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC22M034464. | ||||||||||||
| H-InvDB | HIX0016419. | ||||||||||||
| HGNC | HGNC:9906. RBM9. | ||||||||||||
| HPA | HPA006240. | ||||||||||||
| PharmGKB | PA34272. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | O43251. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O43251. | ||||||||||||
| Bgee | O43251. | ||||||||||||
| CleanEx | HS_RBM9. | ||||||||||||
| GermOnline | ENSG00000100320. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR012677. a_b_plait_nuc_bd. IPR017325. RNA-bd_9/Ataxin-2-bd. IPR000504. RRM_RNP1. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.30.70.330. a_b_plait_nuc_bd. 1 hit. | ||||||||||||
| Pfam | PF00076. RRM_1. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF037932. Ataxin_2_bd_A2BP. 1 hit. | ||||||||||||
| SMART | SM00360. RRM. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50102. RRM. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 46058. | ||||||||||||
Entry information
| Entry name | RBM9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43251 Secondary accession number(s): A4F5G8 Q9UH33 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


