Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA binding protein fox-1 homolog 2

Gene

RBFOX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis (By similarity). RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.By similarity1 Publication

GO - Molecular functioni

  • mRNA binding Source: GO_Central
  • nucleotide binding Source: InterPro
  • poly(A) RNA binding Source: UniProtKB
  • RNA binding Source: UniProtKB
  • transcription corepressor activity Source: UniProtKB
  • transcription factor binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

mRNA processing, mRNA splicing

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

ReactomeiR-HSA-6803529. FGFR2 alternative splicing.

Names & Taxonomyi

Protein namesi
Recommended name:
RNA binding protein fox-1 homolog 2
Alternative name(s):
Fox-1 homolog B
Hexaribonucleotide-binding protein 2
RNA-binding motif protein 9
RNA-binding protein 9
Repressor of tamoxifen transcriptional activity
Gene namesi
Name:RBFOX2
Synonyms:FOX2, HRNBP2, RBM9, RTA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:9906. RBFOX2.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34272.

Polymorphism and mutation databases

BioMutaiRBFOX2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 390390RNA binding protein fox-1 homolog 2PRO_0000081766Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform 6 (identifier: O43251-6)
Modified residuei67 – 671PhosphothreonineCombined sourcesCurated
Isoform 8 (identifier: O43251-8)
Modified residuei67 – 671PhosphothreonineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO43251.
MaxQBiO43251.
PaxDbiO43251.
PRIDEiO43251.

PTM databases

iPTMnetiO43251.
PhosphoSiteiO43251.

Expressioni

Gene expression databases

BgeeiO43251.
CleanExiHS_RBM9.
ExpressionAtlasiO43251. baseline and differential.
GenevisibleiO43251. HS.

Organism-specific databases

HPAiHPA006240.

Interactioni

Subunit structurei

Interacts with ER-alpha N-terminal activation domain.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei122 – 1221Interaction with RNABy similarity
Sitei130 – 1301Interaction with RNABy similarity
Sitei131 – 1311Interaction with RNABy similarity
Sitei155 – 1551Interaction with RNABy similarity
Sitei160 – 1601Interaction with RNABy similarity
Sitei164 – 1641Interaction with RNABy similarity
Sitei188 – 1881Interaction with RNABy similarity
Sitei198 – 1981Interaction with RNABy similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
ATXN1P5425310EBI-746056,EBI-930964
BOLLQ8N9W63EBI-746056,EBI-998198
C1orf94Q6P1W53EBI-746056,EBI-946029
CAMK2BQ135543EBI-746056,EBI-1058722
DAB1O755533EBI-746056,EBI-7875264
DAZAP2Q150384EBI-746056,EBI-724310
ESR1P033724EBI-746056,EBI-78473
HNRNPFP525974EBI-746056,EBI-352986
MAGED1Q9Y5V33EBI-746056,EBI-716006
MAPK1IP1LQ8NDC03EBI-746056,EBI-741424
NAF1Q96HR83EBI-746056,EBI-2515597
PSMA3P257883EBI-746056,EBI-348380
QKIQ96PU83EBI-746056,EBI-945792
RBFOX1Q9NWB12EBI-746056,EBI-945906
RNF8O760643EBI-746056,EBI-373337
VAC14Q08AM63EBI-746056,EBI-2107455

GO - Molecular functioni

  • transcription factor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi117087. 96 interactions.
IntActiO43251. 53 interactions.
MINTiMINT-1437920.
STRINGi9606.ENSP00000413035.

Structurei

Secondary structure

1
390
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi122 – 1276Combined sources
Helixi134 – 1407Combined sources
Helixi141 – 1433Combined sources
Beta strandi147 – 1537Combined sources
Turni156 – 1594Combined sources
Beta strandi162 – 1687Combined sources
Helixi170 – 18011Combined sources
Beta strandi191 – 1944Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2CQ3NMR-A113-202[»]
ProteinModelPortaliO43251.
SMRiO43251. Positions 119-202.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO43251.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini121 – 19777RRMPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi273 – 377105Ala-richAdd
BLAST

Sequence similaritiesi

Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0125. Eukaryota.
ENOG4111WJT. LUCA.
GeneTreeiENSGT00390000013767.
HOVERGENiHBG000044.
InParanoidiO43251.
KOiK14946.
OMAiSTQPHGE.
OrthoDBiEOG7060R3.
PhylomeDBiO43251.
TreeFamiTF315942.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR025670. Fox-1_C_dom.
IPR012677. Nucleotide-bd_a/b_plait.
IPR017325. RNA-bd_Fox-1.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF12414. Fox-1_C. 1 hit.
PF00076. RRM_1. 1 hit.
[Graphical view]
PIRSFiPIRSF037932. Ataxin_2_bd_A2BP. 1 hit.
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43251-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQNEPLTPGY HGFPARDSQG NQEPTTTPDA MVQPFTTIPF PPPPQNGIPT
60 70 80 90 100
EYGVPHTQDY AGQTGEHNLT LYGSTQAHGE QSSNSPSTQN GSLTTEGGAQ
110 120 130 140 150
TDGQQSQTQS SENSESKSTP KRLHVSNIPF RFRDPDLRQM FGQFGKILDV
160 170 180 190 200
EIIFNERGSK GFGFVTFENS ADADRAREKL HGTVVEGRKI EVNNATARVM
210 220 230 240 250
TNKKMVTPYA NGWKLSPVVG AVYGPELYAA SSFQADVSLG NDAAVPLSGR
260 270 280 290 300
GGINTYIPLI SLPLVPGFPY PTAATTAAAF RGAHLRGRGR TVYGAVRAVP
310 320 330 340 350
PTAIPAYPGV VYQDGFYGAD LYGGYAAYRY AQPATATAAT AAAAAAAAYS
360 370 380 390
DGYGRVYTAD PYHALAPAAS YGVGAVASLY RGGYSRFAPY
Length:390
Mass (Da):41,374
Last modified:April 11, 2003 - v3
Checksum:i40D6C8C40764B317
GO
Isoform 2 (identifier: O43251-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     94-94: T → TQ

Show »
Length:381
Mass (Da):40,479
Checksum:i553FE52BD48F7062
GO
Isoform 3 (identifier: O43251-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     143-160: Missing.
     261-265: SLPLV → I

Note: No experimental confirmation available.
Show »
Length:358
Mass (Da):37,879
Checksum:iBA4B3740D2DA6E7A
GO
Isoform 4 (identifier: O43251-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     311-390: VYQDGFYGAD...RGGYSRFAPY → DMQPTDMHSL...TADLPPTEVT

Note: No experimental confirmation available.
Show »
Length:370
Mass (Da):39,783
Checksum:i725D8B1C719AEB10
GO
Isoform 5 (identifier: O43251-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     261-265: SLPLV → I

Note: No experimental confirmation available.
Show »
Length:376
Mass (Da):39,954
Checksum:iA50D5086B4436165
GO
Isoform 6 (identifier: O43251-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGM

Show »
Length:450
Mass (Da):47,215
Checksum:i56D559291EF61ECF
GO
Isoform 7 (identifier: O43251-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-265: SLPLV → I
     323-390: GGYAAYRYAQ...RGGYSRFAPY → IESANCFRSN...TADLPPTEVT

Show »
Length:400
Mass (Da):43,179
Checksum:i6A4D8B3E2FAA5726
GO
Isoform 8 (identifier: O43251-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGM
     94-94: T → TQ

Show »
Length:451
Mass (Da):47,343
Checksum:iF4E92F3CCC76447B
GO
Isoform 9 (identifier: O43251-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     94-94: T → TQ
     261-265: SLPLV → I
     311-390: VYQDGFYGAD...RGGYSRFAPY → DMQPTDMHSL...TADLPPTEVT

Show »
Length:367
Mass (Da):39,515
Checksum:i7A2C1824C39B7FA4
GO
Isoform 10 (identifier: O43251-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT

Show »
Length:380
Mass (Da):40,351
Checksum:i601F4E31E7C20715
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti116 – 1161S → G in AAX84843 (PubMed:14702039).Curated
Sequence conflicti231 – 2311S → F in BAB70875 (PubMed:12529303).Curated
Sequence conflicti346 – 3461A → V in AAH13115 (PubMed:15489334).Curated
Sequence conflicti350 – 3501S → G in BAB70875 (PubMed:12529303).Curated
Isoform 6 (identifier: O43251-6)
Sequence conflicti8 – 81H → Q in BAB70875 (PubMed:12529303).Combined sourcesCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1818MQNEP…PARDS → MEKKKMVT in isoform 2, isoform 3, isoform 4, isoform 5, isoform 9 and isoform 10. 6 PublicationsVSP_007180Add
BLAST
Alternative sequencei1 – 11M → MAEGAQPHQPPQLGPGAAAR GMKRESELELPVPGAGGDGA DPGLSKRPRTEEAAADGGGG M in isoform 6 and isoform 8. 2 PublicationsVSP_030889
Alternative sequencei94 – 941T → TQ in isoform 2, isoform 8 and isoform 9. 3 PublicationsVSP_030890
Alternative sequencei143 – 16018Missing in isoform 3. 1 PublicationVSP_007181Add
BLAST
Alternative sequencei261 – 2655SLPLV → I in isoform 3, isoform 5, isoform 7 and isoform 9. 4 PublicationsVSP_007182
Alternative sequencei311 – 39080VYQDG…RFAPY → DMQPTDMHSLLLQPQPPLLQ PLQPLTVTVMAGCTQPTPTM PLPLPLAMELALWRVYTEVA TADLPPTEVT in isoform 4 and isoform 9. 2 PublicationsVSP_007183Add
BLAST
Alternative sequencei323 – 39068GGYAA…RFAPY → IESANCFRSNRVDMQPTDMH SLLLQPQPPLLQPLQPLTVT VMAGCTQPTPTMPLPLPLAM ELALWRVYTEVATADLPPTE VT in isoform 7. 1 PublicationVSP_030891Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY072786 mRNA. Translation: AAL67150.1.
AF229058 mRNA. Translation: AAL71905.1.
AY960684 mRNA. Translation: AAX84843.1.
AL009266 mRNA. Translation: CAA15842.1.
CR456559 mRNA. Translation: CAG30445.1.
AK055213 mRNA. Translation: BAB70875.1.
AK291460 mRNA. Translation: BAF84149.1.
DQ778625 mRNA. Translation: ABG77459.1.
AL079295, AL049748 Genomic DNA. Translation: CAI19059.1.
AL079295, AL049748 Genomic DNA. Translation: CAQ07599.1.
AL079295, AL049748 Genomic DNA. Translation: CAQ07600.1.
BC013115 mRNA. Translation: AAH13115.1.
BC025281 mRNA. Translation: AAH25281.1.
AM419009 mRNA. Translation: CAL91352.1.
CCDSiCCDS13921.1. [O43251-9]
CCDS43013.1. [O43251-8]
CCDS46699.1. [O43251-4]
CCDS46700.1. [O43251-10]
CCDS46701.1. [O43251-5]
RefSeqiNP_001026865.1. NM_001031695.2. [O43251-10]
NP_001076045.1. NM_001082576.1. [O43251-5]
NP_001076046.1. NM_001082577.1. [O43251-4]
NP_001076047.1. NM_001082578.1.
NP_001076048.1. NM_001082579.1.
NP_055124.1. NM_014309.2. [O43251-9]
XP_005261494.1. XM_005261437.1. [O43251-2]
UniGeneiHs.282998.

Genome annotation databases

EnsembliENST00000262829; ENSP00000262829; ENSG00000100320. [O43251-3]
ENST00000405409; ENSP00000384944; ENSG00000100320. [O43251-9]
ENST00000414461; ENSP00000407855; ENSG00000100320. [O43251-4]
ENST00000416721; ENSP00000405651; ENSG00000100320. [O43251-5]
ENST00000438146; ENSP00000413035; ENSG00000100320. [O43251-8]
ENST00000449924; ENSP00000391670; ENSG00000100320. [O43251-10]
ENST00000618140; ENSP00000482053; ENSG00000277564. [O43251-9]
ENST00000619768; ENSP00000479761; ENSG00000277564. [O43251-10]
ENST00000626107; ENSP00000485984; ENSG00000277564. [O43251-4]
ENST00000627946; ENSP00000487477; ENSG00000277564. [O43251-5]
ENST00000631365; ENSP00000485711; ENSG00000277564. [O43251-3]
GeneIDi23543.
KEGGihsa:23543.
UCSCiuc003aoh.5. human. [O43251-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY072786 mRNA. Translation: AAL67150.1.
AF229058 mRNA. Translation: AAL71905.1.
AY960684 mRNA. Translation: AAX84843.1.
AL009266 mRNA. Translation: CAA15842.1.
CR456559 mRNA. Translation: CAG30445.1.
AK055213 mRNA. Translation: BAB70875.1.
AK291460 mRNA. Translation: BAF84149.1.
DQ778625 mRNA. Translation: ABG77459.1.
AL079295, AL049748 Genomic DNA. Translation: CAI19059.1.
AL079295, AL049748 Genomic DNA. Translation: CAQ07599.1.
AL079295, AL049748 Genomic DNA. Translation: CAQ07600.1.
BC013115 mRNA. Translation: AAH13115.1.
BC025281 mRNA. Translation: AAH25281.1.
AM419009 mRNA. Translation: CAL91352.1.
CCDSiCCDS13921.1. [O43251-9]
CCDS43013.1. [O43251-8]
CCDS46699.1. [O43251-4]
CCDS46700.1. [O43251-10]
CCDS46701.1. [O43251-5]
RefSeqiNP_001026865.1. NM_001031695.2. [O43251-10]
NP_001076045.1. NM_001082576.1. [O43251-5]
NP_001076046.1. NM_001082577.1. [O43251-4]
NP_001076047.1. NM_001082578.1.
NP_001076048.1. NM_001082579.1.
NP_055124.1. NM_014309.2. [O43251-9]
XP_005261494.1. XM_005261437.1. [O43251-2]
UniGeneiHs.282998.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2CQ3NMR-A113-202[»]
ProteinModelPortaliO43251.
SMRiO43251. Positions 119-202.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117087. 96 interactions.
IntActiO43251. 53 interactions.
MINTiMINT-1437920.
STRINGi9606.ENSP00000413035.

PTM databases

iPTMnetiO43251.
PhosphoSiteiO43251.

Polymorphism and mutation databases

BioMutaiRBFOX2.

Proteomic databases

EPDiO43251.
MaxQBiO43251.
PaxDbiO43251.
PRIDEiO43251.

Protocols and materials databases

DNASUi23543.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262829; ENSP00000262829; ENSG00000100320. [O43251-3]
ENST00000405409; ENSP00000384944; ENSG00000100320. [O43251-9]
ENST00000414461; ENSP00000407855; ENSG00000100320. [O43251-4]
ENST00000416721; ENSP00000405651; ENSG00000100320. [O43251-5]
ENST00000438146; ENSP00000413035; ENSG00000100320. [O43251-8]
ENST00000449924; ENSP00000391670; ENSG00000100320. [O43251-10]
ENST00000618140; ENSP00000482053; ENSG00000277564. [O43251-9]
ENST00000619768; ENSP00000479761; ENSG00000277564. [O43251-10]
ENST00000626107; ENSP00000485984; ENSG00000277564. [O43251-4]
ENST00000627946; ENSP00000487477; ENSG00000277564. [O43251-5]
ENST00000631365; ENSP00000485711; ENSG00000277564. [O43251-3]
GeneIDi23543.
KEGGihsa:23543.
UCSCiuc003aoh.5. human. [O43251-1]

Organism-specific databases

CTDi23543.
GeneCardsiRBFOX2.
H-InvDBHIX0016419.
HGNCiHGNC:9906. RBFOX2.
HPAiHPA006240.
MIMi612149. gene.
neXtProtiNX_O43251.
PharmGKBiPA34272.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0125. Eukaryota.
ENOG4111WJT. LUCA.
GeneTreeiENSGT00390000013767.
HOVERGENiHBG000044.
InParanoidiO43251.
KOiK14946.
OMAiSTQPHGE.
OrthoDBiEOG7060R3.
PhylomeDBiO43251.
TreeFamiTF315942.

Enzyme and pathway databases

ReactomeiR-HSA-6803529. FGFR2 alternative splicing.

Miscellaneous databases

ChiTaRSiRBFOX2. human.
EvolutionaryTraceiO43251.
GeneWikiiRBM9.
GenomeRNAii23543.
PROiO43251.
SOURCEiSearch...

Gene expression databases

BgeeiO43251.
CleanExiHS_RBM9.
ExpressionAtlasiO43251. baseline and differential.
GenevisibleiO43251. HS.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR025670. Fox-1_C_dom.
IPR012677. Nucleotide-bd_a/b_plait.
IPR017325. RNA-bd_Fox-1.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF12414. Fox-1_C. 1 hit.
PF00076. RRM_1. 1 hit.
[Graphical view]
PIRSFiPIRSF037932. Ataxin_2_bd_A2BP. 1 hit.
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
  2. Chen W., Winkelmann J.C.
    Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 10).
  3. "A novel isoform of RNA binding motif protein 9."
    Yang G., Huang S.C., Benz E.J. Jr.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  4. "Reevaluating human gene annotation: a second-generation analysis of chromosome 22."
    Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.
    Genome Res. 13:27-36(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9).
    Tissue: Placenta.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 6).
    Tissue: Brain.
  7. Zhou G., Nong W., Li H., Ke R., Shen C., Liang M., Tang Z., Huang B., Lin L., Yang S.
    Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8).
  8. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 10).
    Tissue: Adrenal gland and Uterus.
  10. "XRbm9, a new XGld2-interacting protein, enhances translation in Xenopus oocytes."
    Papin C.
    Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3-390 (ISOFORM 7).
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-67 (ISOFORMS 6 AND 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  13. "Solution structure of RNA binding domain in RNA binding motif protein 9."
    RIKEN structural genomics initiative (RSGI)
    Submitted (NOV-2005) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 113-202.

Entry informationi

Entry nameiRFOX2_HUMAN
AccessioniPrimary (citable) accession number: O43251
Secondary accession number(s): A4F5G8
, A8K5Z5, B0QYY8, B0QYY9, Q0PRL5, Q0VH35, Q5TF71, Q6IC09, Q8TD00, Q8WYB1, Q96DZ6, Q96NL7, Q9UGW4, Q9UH33
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: April 11, 2003
Last modified: June 8, 2016
This is version 161 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.