Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O43236

- SEPT4_HUMAN

UniProt

O43236 - SEPT4_HUMAN

Protein

Septin-4

Gene

SEPT4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 1 (01 Jun 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Filament-forming cytoskeletal GTPase By similarity. May play a role in cytokinesis Potential. May play a role in platelet secretion. Isoform ARTS, but not the other isoforms, is required for the induction of cell death mediated by TGF-beta and by other apoptotic stimuli.By similarity5 PublicationsCurated

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei185 – 1851GTPBy similarity
    Binding sitei211 – 2111GTP; via amide nitrogenBy similarity
    Binding sitei348 – 3481GTP; via amide nitrogen and carbonyl oxygenBy similarity
    Binding sitei363 – 3631GTPBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi151 – 1588GTPBy similarity
    Nucleotide bindingi290 – 2989GTPBy similarity

    GO - Molecular functioni

    1. GTPase activity Source: ProtInc
    2. GTP binding Source: UniProtKB-KW
    3. protein binding Source: IntAct
    4. structural molecule activity Source: ProtInc

    GO - Biological processi

    1. apoptotic process Source: UniProtKB
    2. brain development Source: Ensembl
    3. cytokinesis Source: ProtInc
    4. GTP catabolic process Source: GOC
    5. positive regulation of apoptotic process Source: UniProtKB
    6. positive regulation of intrinsic apoptotic signaling pathway Source: UniProtKB
    7. positive regulation of protein ubiquitination Source: UniProtKB
    8. regulation of apoptotic process Source: UniProtKB
    9. sperm capacitation Source: Ensembl
    10. sperm mitochondrion organization Source: Ensembl

    Keywords - Biological processi

    Cell cycle, Cell division

    Keywords - Ligandi

    GTP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Septin-4
    Alternative name(s):
    Apoptosis-related protein in the TGF-beta signaling pathway
    Short name:
    ARTS
    Bradeion beta
    Brain protein H5
    CE5B3 beta
    Cell division control-related protein 2
    Short name:
    hCDCREL-2
    Cerebral protein 7
    Peanut-like protein 2
    Gene namesi
    Name:SEPT4
    Synonyms:ARTS, PNUTL2, SEP4
    ORF Names:hucep-7
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:9165. SEPT4.

    Subcellular locationi

    Cytoplasm By similarity. Cytoplasmcytoskeleton By similarity
    Note: In platelets, found in areas surrounding alpha-granules.3 Publications
    Isoform ARTS : Mitochondrion. Nucleus
    Note: While predominantly localized in the mitochondria under resting conditions, isoform ARTS translocates into the nucleus after TGF-beta treatment and apoptosis induction.

    GO - Cellular componenti

    1. cytoskeleton Source: UniProtKB-SubCell
    2. mitochondrion Source: UniProtKB
    3. motile cilium Source: Ensembl
    4. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Mitochondrion, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi156 – 1583GKS → ENP: Loss of TGF-beta-induced apoptosis. No translocation to the nucleus following TGF-beta treatment. Loss of XIAP-binding. 1 Publication

    Organism-specific databases

    PharmGKBiPA33487.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 478478Septin-4PRO_0000173519Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei325 – 3251Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO43236.
    PaxDbiO43236.
    PRIDEiO43236.

    PTM databases

    PhosphoSiteiO43236.

    Expressioni

    Tissue specificityi

    Widely expressed in adult and fetal tissues with highest expression in adult brain (at protein level), heart, liver and adrenal gland and fetal heart, kidney, liver and lung. Also expressed in colorectal cancers and malignant melanomas. Expressed in platelets.6 Publications

    Gene expression databases

    ArrayExpressiO43236.
    BgeeiO43236.
    CleanExiHS_SEPT4.
    GenevestigatoriO43236.

    Organism-specific databases

    HPAiCAB006855.
    HPA021587.
    HPA022905.

    Interactioni

    Subunit structurei

    Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation By similarity. Interacts with SEPT8. In a mesenchymal cell line, interacts with SEPT9 isoform 2 variants HNA Trp-106 and Phe-111, but not the wild type SEPT9. Isoform ARTS, but no other isoforms, interacts with XIAP after the induction of apoptosis.By similarity3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    SIAH1Q8IUQ42EBI-4372019,EBI-747107
    XIAPP981704EBI-4372019,EBI-517127

    Protein-protein interaction databases

    BioGridi111415. 7 interactions.
    IntActiO43236. 6 interactions.
    MINTiMINT-2999234.
    STRINGi9606.ENSP00000321674.

    Structurei

    3D structure databases

    DisProtiDP00537.
    ProteinModelPortaliO43236.
    SMRiO43236. Positions 141-410.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini141 – 414274Septin-type GAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili447 – 47832Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiCOG5019.
    HOVERGENiHBG065093.
    InParanoidiO43236.
    KOiK16943.
    OMAiKRQSADI.
    OrthoDBiEOG79KPF0.
    PhylomeDBiO43236.
    TreeFamiTF101079.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR000038. Cell_div_GTP-bd.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PANTHERiPTHR18884. PTHR18884. 1 hit.
    PfamiPF00735. Septin. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.
    PROSITEiPS51719. G_SEPTIN. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O43236-1) [UniParc]FASTAAdd to Basket

    Also known as: PNUTL2, PNUTL2a, H5/CDCrel2, SEPT4_i1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDRSLGWQGN SVPEDRTEAG IKRFLEDTTD DGELSKFVKD FSGNASCHPP    50
    EAKTWASRPQ VPEPRPQAPD LYDDDLEFRP PSRPQSSDNQ QYFCAPAPLS 100
    PSARPRSPWG KLDPYDSSED DKEYVGFATL PNQVHRKSVK KGFDFTLMVA 150
    GESGLGKSTL VNSLFLTDLY RDRKLLGAEE RIMQTVEITK HAVDIEEKGV 200
    RLRLTIVDTP GFGDAVNNTE CWKPVAEYID QQFEQYFRDE SGLNRKNIQD 250
    NRVHCCLYFI SPFGHGLRPL DVEFMKALHQ RVNIVPILAK ADTLTPPEVD 300
    HKKRKIREEI EHFGIKIYQF PDCDSDEDED FKLQDQALKE SIPFAVIGSN 350
    TVVEARGRRV RGRLYPWGIV EVENPGHCDF VKLRTMLVRT HMQDLKDVTR 400
    ETHYENYRAQ CIQSMTRLVV KERNRNKLTR ESGTDFPIPA VPPGTDPETE 450
    KLIREKDEEL RRMQEMLHKI QKQMKENY 478
    Length:478
    Mass (Da):55,098
    Last modified:June 1, 1998 - v1
    Checksum:i2F08D3611EF6523D
    GO
    Isoform 2 (identifier: O43236-2) [UniParc]FASTAAdd to Basket

    Also known as: PNUTL2b

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MDRSLGWQGNSVPEDRTEAG → M

    Show »
    Length:459
    Mass (Da):53,042
    Checksum:iC0779A770DC7415A
    GO
    Isoform 3 (identifier: O43236-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MDRSLGWQGNSVPEDRTEAG → MPGFYSVMTDEE

    Note: No experimental confirmation available.

    Show »
    Length:470
    Mass (Da):54,298
    Checksum:iBDBB6EB9570D9913
    GO
    Isoform 4 (identifier: O43236-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MDRSLGWQGNSVPEDRTEAG → MRSSPALFSSRAAPQKPRKEGSQAAGLLVFSDSLE

    Note: No experimental confirmation available.

    Show »
    Length:493
    Mass (Da):56,613
    Checksum:iD015198B93C0ED49
    GO
    Isoform 5 (identifier: O43236-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-147: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:331
    Mass (Da):38,542
    Checksum:iA860BD705573901C
    GO
    Isoform ARTS (identifier: O43236-6) [UniParc]FASTAAdd to Basket

    Also known as: SEPT4_i2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MDRSLGWQGNSVPEDRTEAG → M
         267-293: LRPLDVEFMKALHQRVNIVPILAKADT → YGPSLRLLAPPGAVKGTGQEHQGQGCH
         294-478: Missing.

    Note: May be defective in GTP-binding.

    Show »
    Length:274
    Mass (Da):30,809
    Checksum:i7FA8D55492E9348F
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti156 – 1561G → D in BAG37789. 1 PublicationCurated
    Sequence conflicti382 – 3821K → E in BAG63517. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti311 – 3111E → V.
    Corresponds to variant rs17741424 [ dbSNP | Ensembl ].
    VAR_051935

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 147147Missing in isoform 5. 1 PublicationVSP_038302Add
    BLAST
    Alternative sequencei1 – 2020MDRSL…RTEAG → M in isoform 2 and isoform ARTS. 4 PublicationsVSP_006050Add
    BLAST
    Alternative sequencei1 – 2020MDRSL…RTEAG → MPGFYSVMTDEE in isoform 3. 1 PublicationVSP_038303Add
    BLAST
    Alternative sequencei1 – 2020MDRSL…RTEAG → MRSSPALFSSRAAPQKPRKE GSQAAGLLVFSDSLE in isoform 4. 1 PublicationVSP_038304Add
    BLAST
    Alternative sequencei267 – 29327LRPLD…AKADT → YGPSLRLLAPPGAVKGTGQE HQGQGCH in isoform ARTS. 1 PublicationVSP_038305Add
    BLAST
    Alternative sequencei294 – 478185Missing in isoform ARTS. 1 PublicationVSP_038306Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF073312 mRNA. Translation: AAC25673.1.
    U88829 mRNA. Translation: AAD00653.1.
    U88870 mRNA. Translation: AAD00657.1.
    AF176379 mRNA. Translation: AAG45673.1.
    AB008753 mRNA. Translation: BAB70695.1.
    D89278 mRNA. Translation: BAB46922.1.
    AF035811 mRNA. Translation: AAB88512.1.
    CR457111 mRNA. Translation: CAG33392.1.
    AK315396 mRNA. Translation: BAG37789.1.
    AK094579 mRNA. Translation: BAG52891.1.
    AK294094 mRNA. Translation: BAG57432.1.
    AK301914 mRNA. Translation: BAG63338.1.
    AK302146 mRNA. Translation: BAG63517.1.
    CH471109 Genomic DNA. Translation: EAW94440.1.
    CH471109 Genomic DNA. Translation: EAW94442.1.
    BC018056 mRNA. Translation: AAH18056.3.
    CCDSiCCDS11609.1. [O43236-2]
    CCDS11610.1. [O43236-1]
    CCDS45743.1. [O43236-6]
    CCDS56041.1. [O43236-3]
    CCDS58581.1. [O43236-5]
    CCDS58582.1. [O43236-4]
    RefSeqiNP_001185642.1. NM_001198713.1. [O43236-3]
    NP_001243711.1. NM_001256782.1. [O43236-4]
    NP_001243751.1. NM_001256822.1. [O43236-5]
    NP_004565.1. NM_004574.4. [O43236-1]
    NP_536340.1. NM_080415.3. [O43236-6]
    NP_536341.1. NM_080416.3. [O43236-2]
    XP_006722016.1. XM_006721953.1. [O43236-5]
    XP_006722017.1. XM_006721954.1. [O43236-5]
    XP_006722018.1. XM_006721955.1. [O43236-5]
    UniGeneiHs.287518.

    Genome annotation databases

    EnsembliENST00000317256; ENSP00000321071; ENSG00000108387. [O43236-2]
    ENST00000317268; ENSP00000321674; ENSG00000108387. [O43236-1]
    ENST00000393086; ENSP00000376801; ENSG00000108387. [O43236-2]
    ENST00000412945; ENSP00000414779; ENSG00000108387. [O43236-3]
    ENST00000426861; ENSP00000402348; ENSG00000108387. [O43236-6]
    ENST00000457347; ENSP00000402000; ENSG00000108387. [O43236-4]
    ENST00000583114; ENSP00000463768; ENSG00000108387. [O43236-5]
    GeneIDi5414.
    KEGGihsa:5414.
    UCSCiuc002iwk.2. human. [O43236-1]
    uc002iwo.2. human. [O43236-2]
    uc002iwp.2. human. [O43236-6]
    uc010wnx.2. human. [O43236-4]
    uc010wny.2. human. [O43236-3]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF073312 mRNA. Translation: AAC25673.1 .
    U88829 mRNA. Translation: AAD00653.1 .
    U88870 mRNA. Translation: AAD00657.1 .
    AF176379 mRNA. Translation: AAG45673.1 .
    AB008753 mRNA. Translation: BAB70695.1 .
    D89278 mRNA. Translation: BAB46922.1 .
    AF035811 mRNA. Translation: AAB88512.1 .
    CR457111 mRNA. Translation: CAG33392.1 .
    AK315396 mRNA. Translation: BAG37789.1 .
    AK094579 mRNA. Translation: BAG52891.1 .
    AK294094 mRNA. Translation: BAG57432.1 .
    AK301914 mRNA. Translation: BAG63338.1 .
    AK302146 mRNA. Translation: BAG63517.1 .
    CH471109 Genomic DNA. Translation: EAW94440.1 .
    CH471109 Genomic DNA. Translation: EAW94442.1 .
    BC018056 mRNA. Translation: AAH18056.3 .
    CCDSi CCDS11609.1. [O43236-2 ]
    CCDS11610.1. [O43236-1 ]
    CCDS45743.1. [O43236-6 ]
    CCDS56041.1. [O43236-3 ]
    CCDS58581.1. [O43236-5 ]
    CCDS58582.1. [O43236-4 ]
    RefSeqi NP_001185642.1. NM_001198713.1. [O43236-3 ]
    NP_001243711.1. NM_001256782.1. [O43236-4 ]
    NP_001243751.1. NM_001256822.1. [O43236-5 ]
    NP_004565.1. NM_004574.4. [O43236-1 ]
    NP_536340.1. NM_080415.3. [O43236-6 ]
    NP_536341.1. NM_080416.3. [O43236-2 ]
    XP_006722016.1. XM_006721953.1. [O43236-5 ]
    XP_006722017.1. XM_006721954.1. [O43236-5 ]
    XP_006722018.1. XM_006721955.1. [O43236-5 ]
    UniGenei Hs.287518.

    3D structure databases

    DisProti DP00537.
    ProteinModelPortali O43236.
    SMRi O43236. Positions 141-410.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111415. 7 interactions.
    IntActi O43236. 6 interactions.
    MINTi MINT-2999234.
    STRINGi 9606.ENSP00000321674.

    PTM databases

    PhosphoSitei O43236.

    Proteomic databases

    MaxQBi O43236.
    PaxDbi O43236.
    PRIDEi O43236.

    Protocols and materials databases

    DNASUi 5414.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000317256 ; ENSP00000321071 ; ENSG00000108387 . [O43236-2 ]
    ENST00000317268 ; ENSP00000321674 ; ENSG00000108387 . [O43236-1 ]
    ENST00000393086 ; ENSP00000376801 ; ENSG00000108387 . [O43236-2 ]
    ENST00000412945 ; ENSP00000414779 ; ENSG00000108387 . [O43236-3 ]
    ENST00000426861 ; ENSP00000402348 ; ENSG00000108387 . [O43236-6 ]
    ENST00000457347 ; ENSP00000402000 ; ENSG00000108387 . [O43236-4 ]
    ENST00000583114 ; ENSP00000463768 ; ENSG00000108387 . [O43236-5 ]
    GeneIDi 5414.
    KEGGi hsa:5414.
    UCSCi uc002iwk.2. human. [O43236-1 ]
    uc002iwo.2. human. [O43236-2 ]
    uc002iwp.2. human. [O43236-6 ]
    uc010wnx.2. human. [O43236-4 ]
    uc010wny.2. human. [O43236-3 ]

    Organism-specific databases

    CTDi 5414.
    GeneCardsi GC17M056597.
    HGNCi HGNC:9165. SEPT4.
    HPAi CAB006855.
    HPA021587.
    HPA022905.
    MIMi 603696. gene.
    neXtProti NX_O43236.
    PharmGKBi PA33487.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5019.
    HOVERGENi HBG065093.
    InParanoidi O43236.
    KOi K16943.
    OMAi KRQSADI.
    OrthoDBi EOG79KPF0.
    PhylomeDBi O43236.
    TreeFami TF101079.

    Miscellaneous databases

    GeneWikii SEPT4.
    GenomeRNAii 5414.
    NextBioi 20961.
    PROi O43236.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O43236.
    Bgeei O43236.
    CleanExi HS_SEPT4.
    Genevestigatori O43236.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR000038. Cell_div_GTP-bd.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    PANTHERi PTHR18884. PTHR18884. 1 hit.
    Pfami PF00735. Septin. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    PROSITEi PS51719. G_SEPTIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of a novel gene, PNUTL2, on human chromosome 17q22-q23 and its exclusion as the Meckel syndrome gene."
      Paavola P., Horelli-Kuitunen N., Palotie A., Peltonen L.
      Genomics 55:122-125(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
    2. "Characterization and expression analysis of two human septin genes, PNUTL1 and PNUTL2."
      Zieger B., Tran H., Hainmann I., Wunderle D., Zgaga-Griesz A., Blaeser S., Ware J.
      Gene 261:197-203(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
      Tissue: Brain and Fetal brain.
    3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ARTS), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, MUTAGENESIS OF 156-GLY--SER-158.
      Tissue: Fetal brain.
    4. "Characterization of tissue- and cell-type-specific expression of a novel human septin family gene, Bradeion."
      Tanaka M., Tanaka T., Kijima H., Itoh J., Matsuda T., Hori S., Yamamoto M.
      Biochem. Biophys. Res. Commun. 286:547-553(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Brain.
    5. "Molecular cloning of a new GTP binding protein from human brain."
      Yoshimoto M., Yazaki M., Matsumoto K., Takayama K.
      Submitted (NOV-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    6. Zha D., Hu G.
      Submitted (NOV-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    7. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    8. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
      Tissue: Amygdala, Brain cortex, Subthalamic nucleus and Testis.
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Hippocampus.
    11. Cited for: FUNCTION, INTERACTION WITH SEPT8, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    12. Lubec G., Chen W.-Q.
      Submitted (JAN-2009) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 141-157 AND 282-290, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Fetal brain.
    13. "Regulation of the proapoptotic ARTS protein by ubiquitin-mediated degradation."
      Lotan R., Rotem A., Gonen H., Finberg J.P.M., Kemeny S., Steller H., Ciechanover A., Larisch S.
      J. Biol. Chem. 280:25802-25810(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    14. "Expression profiling the human septin gene family."
      Hall P.A., Jung K., Hillan K.J., Russell S.E.H.
      J. Pathol. 206:269-278(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    15. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
      Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
      Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-325, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    16. "SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling."
      Sudo K., Ito H., Iwamoto I., Morishita R., Asano T., Nagata K.
      Hum. Mutat. 28:1005-1013(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SEPT9 HNA VARIANTS.
    17. "The mitochondrial ARTS protein promotes apoptosis through targeting XIAP."
      Gottfried Y., Rotem A., Lotan R., Steller H., Larisch S.
      EMBO J. 23:1627-1635(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH XIAP.

    Entry informationi

    Entry nameiSEPT4_HUMAN
    AccessioniPrimary (citable) accession number: O43236
    Secondary accession number(s): B2RD42
    , B3KSX9, B4DXC6, B4DXV5, Q6IAP3, Q9H315, Q9UM58
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: June 1, 1998
    Last modified: October 1, 2014
    This is version 129 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3