Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Septin-4

Gene

SEPT4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential). May play a role in platelet secretion. Isoform ARTS, but not the other isoforms, is required for the induction of cell death mediated by TGF-beta and by other apoptotic stimuli.By similarityCurated5 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei185 – 1851GTPBy similarity
Binding sitei211 – 2111GTP; via amide nitrogenBy similarity
Binding sitei348 – 3481GTP; via amide nitrogen and carbonyl oxygenBy similarity
Binding sitei363 – 3631GTPBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi151 – 1588GTPBy similarity
Nucleotide bindingi290 – 2989GTPBy similarity

GO - Molecular functioni

  • GTPase activity Source: ProtInc
  • GTP binding Source: UniProtKB-KW
  • structural molecule activity Source: ProtInc

GO - Biological processi

  • apoptotic process Source: UniProtKB
  • brain development Source: Ensembl
  • cell cycle Source: UniProtKB-KW
  • cell division Source: UniProtKB-KW
  • metabolic process Source: GOC
  • positive regulation of apoptotic process Source: UniProtKB
  • positive regulation of intrinsic apoptotic signaling pathway Source: UniProtKB
  • positive regulation of protein ubiquitination Source: UniProtKB
  • regulation of apoptotic process Source: UniProtKB
  • sperm capacitation Source: Ensembl
  • sperm mitochondrion organization Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Septin-4
Alternative name(s):
Apoptosis-related protein in the TGF-beta signaling pathway
Short name:
ARTS
Bradeion beta
Brain protein H5
CE5B3 beta
Cell division control-related protein 2
Short name:
hCDCREL-2
Cerebral protein 7
Peanut-like protein 2
Gene namesi
Name:SEPT4
Synonyms:ARTS, PNUTL2, SEP4
ORF Names:hucep-7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:9165. SEPT4.

Subcellular locationi

Isoform ARTS :
  • Mitochondrion
  • Nucleus

  • Note: While predominantly localized in the mitochondria under resting conditions, isoform ARTS translocates into the nucleus after TGF-beta treatment and apoptosis induction.

GO - Cellular componenti

  • cytoskeleton Source: UniProtKB-SubCell
  • mitochondrion Source: UniProtKB
  • myelin sheath Source: Ensembl
  • nucleus Source: UniProtKB
  • sperm annulus Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Mitochondrion, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi156 – 1583GKS → ENP: Loss of TGF-beta-induced apoptosis. No translocation to the nucleus following TGF-beta treatment. Loss of XIAP-binding. 1 Publication

Organism-specific databases

PharmGKBiPA33487.

Polymorphism and mutation databases

BioMutaiSEPT4.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 478478Septin-4PRO_0000173519Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei117 – 1171Phosphoserine1 Publication
Modified residuei118 – 1181Phosphoserine1 Publication
Modified residuei325 – 3251Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO43236.
PaxDbiO43236.
PRIDEiO43236.

PTM databases

PhosphoSiteiO43236.

Expressioni

Tissue specificityi

Widely expressed in adult and fetal tissues with highest expression in adult brain (at protein level), heart, liver and adrenal gland and fetal heart, kidney, liver and lung. Also expressed in colorectal cancers and malignant melanomas. Expressed in platelets.6 Publications

Gene expression databases

BgeeiO43236.
CleanExiHS_SEPT4.
ExpressionAtlasiO43236. baseline and differential.
GenevisibleiO43236. HS.

Organism-specific databases

HPAiCAB006855.
HPA021587.
HPA022905.

Interactioni

Subunit structurei

Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation (By similarity). Interacts with SEPT8. In a mesenchymal cell line, interacts with SEPT9 isoform 2 variants HNA Trp-106 and Phe-111, but not the wild type SEPT9. Isoform ARTS, but no other isoforms, interacts with XIAP after the induction of apoptosis.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
SIAH1Q8IUQ42EBI-4372019,EBI-747107
XIAPP981704EBI-4372019,EBI-517127

Protein-protein interaction databases

BioGridi111415. 11 interactions.
IntActiO43236. 7 interactions.
MINTiMINT-2999234.
STRINGi9606.ENSP00000321674.

Structurei

3D structure databases

DisProtiDP00537.
ProteinModelPortaliO43236.
SMRiO43236. Positions 141-410.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini141 – 414274Septin-type GAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili447 – 47832Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG5019.
GeneTreeiENSGT00760000118899.
HOVERGENiHBG065093.
InParanoidiO43236.
KOiK16943.
OMAiPPEVDRK.
OrthoDBiEOG79KPF0.
PhylomeDBiO43236.
TreeFamiTF101079.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR030379. G_SEPTIN_dom.
IPR027417. P-loop_NTPase.
IPR016491. Septin.
IPR030643. Septin4.
[Graphical view]
PANTHERiPTHR18884. PTHR18884. 1 hit.
PTHR18884:SF2. PTHR18884:SF2. 1 hit.
PfamiPF00735. Septin. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS51719. G_SEPTIN. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43236-1) [UniParc]FASTAAdd to basket

Also known as: PNUTL2, PNUTL2a, H5/CDCrel2, SEPT4_i1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRSLGWQGN SVPEDRTEAG IKRFLEDTTD DGELSKFVKD FSGNASCHPP
60 70 80 90 100
EAKTWASRPQ VPEPRPQAPD LYDDDLEFRP PSRPQSSDNQ QYFCAPAPLS
110 120 130 140 150
PSARPRSPWG KLDPYDSSED DKEYVGFATL PNQVHRKSVK KGFDFTLMVA
160 170 180 190 200
GESGLGKSTL VNSLFLTDLY RDRKLLGAEE RIMQTVEITK HAVDIEEKGV
210 220 230 240 250
RLRLTIVDTP GFGDAVNNTE CWKPVAEYID QQFEQYFRDE SGLNRKNIQD
260 270 280 290 300
NRVHCCLYFI SPFGHGLRPL DVEFMKALHQ RVNIVPILAK ADTLTPPEVD
310 320 330 340 350
HKKRKIREEI EHFGIKIYQF PDCDSDEDED FKLQDQALKE SIPFAVIGSN
360 370 380 390 400
TVVEARGRRV RGRLYPWGIV EVENPGHCDF VKLRTMLVRT HMQDLKDVTR
410 420 430 440 450
ETHYENYRAQ CIQSMTRLVV KERNRNKLTR ESGTDFPIPA VPPGTDPETE
460 470
KLIREKDEEL RRMQEMLHKI QKQMKENY
Length:478
Mass (Da):55,098
Last modified:June 1, 1998 - v1
Checksum:i2F08D3611EF6523D
GO
Isoform 2 (identifier: O43236-2) [UniParc]FASTAAdd to basket

Also known as: PNUTL2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDRSLGWQGNSVPEDRTEAG → M

Show »
Length:459
Mass (Da):53,042
Checksum:iC0779A770DC7415A
GO
Isoform 3 (identifier: O43236-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDRSLGWQGNSVPEDRTEAG → MPGFYSVMTDEE

Note: No experimental confirmation available.
Show »
Length:470
Mass (Da):54,298
Checksum:iBDBB6EB9570D9913
GO
Isoform 4 (identifier: O43236-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDRSLGWQGNSVPEDRTEAG → MRSSPALFSSRAAPQKPRKEGSQAAGLLVFSDSLE

Note: No experimental confirmation available.
Show »
Length:493
Mass (Da):56,613
Checksum:iD015198B93C0ED49
GO
Isoform 5 (identifier: O43236-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-147: Missing.

Note: No experimental confirmation available.
Show »
Length:331
Mass (Da):38,542
Checksum:iA860BD705573901C
GO
Isoform ARTS (identifier: O43236-6) [UniParc]FASTAAdd to basket

Also known as: SEPT4_i2

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDRSLGWQGNSVPEDRTEAG → M
     267-293: LRPLDVEFMKALHQRVNIVPILAKADT → YGPSLRLLAPPGAVKGTGQEHQGQGCH
     294-478: Missing.

Note: May be defective in GTP-binding.
Show »
Length:274
Mass (Da):30,809
Checksum:i7FA8D55492E9348F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti156 – 1561G → D in BAG37789 (Ref. 7) Curated
Sequence conflicti382 – 3821K → E in BAG63517 (Ref. 7) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti311 – 3111E → V.
Corresponds to variant rs17741424 [ dbSNP | Ensembl ].
VAR_051935

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 147147Missing in isoform 5. 1 PublicationVSP_038302Add
BLAST
Alternative sequencei1 – 2020MDRSL…RTEAG → M in isoform 2 and isoform ARTS. 4 PublicationsVSP_006050Add
BLAST
Alternative sequencei1 – 2020MDRSL…RTEAG → MPGFYSVMTDEE in isoform 3. 1 PublicationVSP_038303Add
BLAST
Alternative sequencei1 – 2020MDRSL…RTEAG → MRSSPALFSSRAAPQKPRKE GSQAAGLLVFSDSLE in isoform 4. 1 PublicationVSP_038304Add
BLAST
Alternative sequencei267 – 29327LRPLD…AKADT → YGPSLRLLAPPGAVKGTGQE HQGQGCH in isoform ARTS. 1 PublicationVSP_038305Add
BLAST
Alternative sequencei294 – 478185Missing in isoform ARTS. 1 PublicationVSP_038306Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073312 mRNA. Translation: AAC25673.1.
U88829 mRNA. Translation: AAD00653.1.
U88870 mRNA. Translation: AAD00657.1.
AF176379 mRNA. Translation: AAG45673.1.
AB008753 mRNA. Translation: BAB70695.1.
D89278 mRNA. Translation: BAB46922.1.
AF035811 mRNA. Translation: AAB88512.1.
CR457111 mRNA. Translation: CAG33392.1.
AK315396 mRNA. Translation: BAG37789.1.
AK094579 mRNA. Translation: BAG52891.1.
AK294094 mRNA. Translation: BAG57432.1.
AK301914 mRNA. Translation: BAG63338.1.
AK302146 mRNA. Translation: BAG63517.1.
CH471109 Genomic DNA. Translation: EAW94440.1.
CH471109 Genomic DNA. Translation: EAW94442.1.
BC018056 mRNA. Translation: AAH18056.3.
CCDSiCCDS11609.1. [O43236-2]
CCDS11610.1. [O43236-1]
CCDS45743.1. [O43236-6]
CCDS56041.1. [O43236-3]
CCDS58581.1. [O43236-5]
CCDS58582.1. [O43236-4]
RefSeqiNP_001185642.1. NM_001198713.1. [O43236-3]
NP_001243711.1. NM_001256782.1. [O43236-4]
NP_001243751.1. NM_001256822.1. [O43236-5]
NP_004565.1. NM_004574.4. [O43236-1]
NP_536340.1. NM_080415.3. [O43236-6]
NP_536341.1. NM_080416.3. [O43236-2]
XP_006722017.1. XM_006721954.1. [O43236-5]
XP_006722018.1. XM_006721955.1. [O43236-5]
XP_011523213.1. XM_011524911.1. [O43236-5]
XP_011523214.1. XM_011524912.1. [O43236-5]
UniGeneiHs.287518.

Genome annotation databases

EnsembliENST00000317256; ENSP00000321071; ENSG00000108387. [O43236-2]
ENST00000317268; ENSP00000321674; ENSG00000108387.
ENST00000393086; ENSP00000376801; ENSG00000108387. [O43236-2]
ENST00000412945; ENSP00000414779; ENSG00000108387. [O43236-3]
ENST00000426861; ENSP00000402348; ENSG00000108387. [O43236-6]
ENST00000457347; ENSP00000402000; ENSG00000108387. [O43236-4]
ENST00000583114; ENSP00000463768; ENSG00000108387. [O43236-5]
GeneIDi5414.
KEGGihsa:5414.
UCSCiuc002iwk.2. human. [O43236-1]
uc002iwo.2. human. [O43236-2]
uc002iwp.2. human. [O43236-6]
uc010wnx.2. human. [O43236-4]
uc010wny.2. human. [O43236-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073312 mRNA. Translation: AAC25673.1.
U88829 mRNA. Translation: AAD00653.1.
U88870 mRNA. Translation: AAD00657.1.
AF176379 mRNA. Translation: AAG45673.1.
AB008753 mRNA. Translation: BAB70695.1.
D89278 mRNA. Translation: BAB46922.1.
AF035811 mRNA. Translation: AAB88512.1.
CR457111 mRNA. Translation: CAG33392.1.
AK315396 mRNA. Translation: BAG37789.1.
AK094579 mRNA. Translation: BAG52891.1.
AK294094 mRNA. Translation: BAG57432.1.
AK301914 mRNA. Translation: BAG63338.1.
AK302146 mRNA. Translation: BAG63517.1.
CH471109 Genomic DNA. Translation: EAW94440.1.
CH471109 Genomic DNA. Translation: EAW94442.1.
BC018056 mRNA. Translation: AAH18056.3.
CCDSiCCDS11609.1. [O43236-2]
CCDS11610.1. [O43236-1]
CCDS45743.1. [O43236-6]
CCDS56041.1. [O43236-3]
CCDS58581.1. [O43236-5]
CCDS58582.1. [O43236-4]
RefSeqiNP_001185642.1. NM_001198713.1. [O43236-3]
NP_001243711.1. NM_001256782.1. [O43236-4]
NP_001243751.1. NM_001256822.1. [O43236-5]
NP_004565.1. NM_004574.4. [O43236-1]
NP_536340.1. NM_080415.3. [O43236-6]
NP_536341.1. NM_080416.3. [O43236-2]
XP_006722017.1. XM_006721954.1. [O43236-5]
XP_006722018.1. XM_006721955.1. [O43236-5]
XP_011523213.1. XM_011524911.1. [O43236-5]
XP_011523214.1. XM_011524912.1. [O43236-5]
UniGeneiHs.287518.

3D structure databases

DisProtiDP00537.
ProteinModelPortaliO43236.
SMRiO43236. Positions 141-410.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111415. 11 interactions.
IntActiO43236. 7 interactions.
MINTiMINT-2999234.
STRINGi9606.ENSP00000321674.

PTM databases

PhosphoSiteiO43236.

Polymorphism and mutation databases

BioMutaiSEPT4.

Proteomic databases

MaxQBiO43236.
PaxDbiO43236.
PRIDEiO43236.

Protocols and materials databases

DNASUi5414.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317256; ENSP00000321071; ENSG00000108387. [O43236-2]
ENST00000317268; ENSP00000321674; ENSG00000108387.
ENST00000393086; ENSP00000376801; ENSG00000108387. [O43236-2]
ENST00000412945; ENSP00000414779; ENSG00000108387. [O43236-3]
ENST00000426861; ENSP00000402348; ENSG00000108387. [O43236-6]
ENST00000457347; ENSP00000402000; ENSG00000108387. [O43236-4]
ENST00000583114; ENSP00000463768; ENSG00000108387. [O43236-5]
GeneIDi5414.
KEGGihsa:5414.
UCSCiuc002iwk.2. human. [O43236-1]
uc002iwo.2. human. [O43236-2]
uc002iwp.2. human. [O43236-6]
uc010wnx.2. human. [O43236-4]
uc010wny.2. human. [O43236-3]

Organism-specific databases

CTDi5414.
GeneCardsiGC17M056597.
HGNCiHGNC:9165. SEPT4.
HPAiCAB006855.
HPA021587.
HPA022905.
MIMi603696. gene.
neXtProtiNX_O43236.
PharmGKBiPA33487.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5019.
GeneTreeiENSGT00760000118899.
HOVERGENiHBG065093.
InParanoidiO43236.
KOiK16943.
OMAiPPEVDRK.
OrthoDBiEOG79KPF0.
PhylomeDBiO43236.
TreeFamiTF101079.

Miscellaneous databases

ChiTaRSiSEPT4. human.
GeneWikiiSEPT4.
GenomeRNAii5414.
NextBioi20961.
PROiO43236.
SOURCEiSearch...

Gene expression databases

BgeeiO43236.
CleanExiHS_SEPT4.
ExpressionAtlasiO43236. baseline and differential.
GenevisibleiO43236. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR030379. G_SEPTIN_dom.
IPR027417. P-loop_NTPase.
IPR016491. Septin.
IPR030643. Septin4.
[Graphical view]
PANTHERiPTHR18884. PTHR18884. 1 hit.
PTHR18884:SF2. PTHR18884:SF2. 1 hit.
PfamiPF00735. Septin. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS51719. G_SEPTIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of a novel gene, PNUTL2, on human chromosome 17q22-q23 and its exclusion as the Meckel syndrome gene."
    Paavola P., Horelli-Kuitunen N., Palotie A., Peltonen L.
    Genomics 55:122-125(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
  2. "Characterization and expression analysis of two human septin genes, PNUTL1 and PNUTL2."
    Zieger B., Tran H., Hainmann I., Wunderle D., Zgaga-Griesz A., Blaeser S., Ware J.
    Gene 261:197-203(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
    Tissue: Brain and Fetal brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ARTS), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, MUTAGENESIS OF 156-GLY--SER-158.
    Tissue: Fetal brain.
  4. "Characterization of tissue- and cell-type-specific expression of a novel human septin family gene, Bradeion."
    Tanaka M., Tanaka T., Kijima H., Itoh J., Matsuda T., Hori S., Yamamoto M.
    Biochem. Biophys. Res. Commun. 286:547-553(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Brain.
  5. "Molecular cloning of a new GTP binding protein from human brain."
    Yoshimoto M., Yazaki M., Matsumoto K., Takayama K.
    Submitted (NOV-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  6. Zha D., Hu G.
    Submitted (NOV-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  7. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  8. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
    Tissue: Amygdala, Brain cortex, Subthalamic nucleus and Testis.
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Hippocampus.
  11. Cited for: FUNCTION, INTERACTION WITH SEPT8, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  12. Lubec G., Chen W.-Q.
    Submitted (JAN-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 141-157 AND 282-290, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Fetal brain.
  13. "Regulation of the proapoptotic ARTS protein by ubiquitin-mediated degradation."
    Lotan R., Rotem A., Gonen H., Finberg J.P.M., Kemeny S., Steller H., Ciechanover A., Larisch S.
    J. Biol. Chem. 280:25802-25810(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  14. "Expression profiling the human septin gene family."
    Hall P.A., Jung K., Hillan K.J., Russell S.E.H.
    J. Pathol. 206:269-278(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  15. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
    Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
    Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-325, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  16. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-117; SER-118 AND SER-325, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  17. "SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling."
    Sudo K., Ito H., Iwamoto I., Morishita R., Asano T., Nagata K.
    Hum. Mutat. 28:1005-1013(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SEPT9 HNA VARIANTS.
  18. "The mitochondrial ARTS protein promotes apoptosis through targeting XIAP."
    Gottfried Y., Rotem A., Lotan R., Steller H., Larisch S.
    EMBO J. 23:1627-1635(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH XIAP.

Entry informationi

Entry nameiSEPT4_HUMAN
AccessioniPrimary (citable) accession number: O43236
Secondary accession number(s): B2RD42
, B3KSX9, B4DXC6, B4DXV5, Q6IAP3, Q9H315, Q9UM58
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: June 1, 1998
Last modified: July 22, 2015
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.