Reviewed,
UniProtKB/Swiss-Prot O43184 (ADA12_HUMAN)
Last modified
June 16, 2009.
Version 96.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Disintegrin and metalloproteinase domain-containing protein 12 Short name=ADAM 12 EC=3.4.24.- Alternative name(s): Meltrin-alpha | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 909 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors By similarity. |
| Cofactor | Binds 1 zinc ion per subunit. |
| Subunit structure | Interacts with alpha-actinin-2 and with syndecans By similarity. Interacts with SH3PXD2A. |
| Subcellular location | Isoform 1: Cell membrane; Single-pass type I membrane protein. Isoform 2: Secreted. Isoform 3: Secreted Potential. Isoform 4: Secreted Potential. |
| Tissue specificity | Isoform 1 is expressed in placenta and skeletal, cardiac, and smooth muscle. Isoform 2 seems to be expressed only in placenta or in embryo and fetus. Both forms were expressed in some tumor cells lines. Not detected in brain, lung, liver, kidney or pancreas. |
| Domain | The cysteine-rich domain supports cell adhesion through syndecans and triggers signaling events that lead to beta-1 integrin-dependent cell spreading. In carcinomas cells the binding of this domain to syndecans does not allow the integrin-mediated cell spreading. The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. |
| Post-translational modification | The precursor is cleaved by a furin endopeptidase By similarity. |
| Sequence similarities | Contains 1 disintegrin domain. Contains 1 EGF-like domain. Contains 1 peptidase M12B domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43184-1) Also known as: 12L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43184-2) Also known as: 12S; The sequence of this isoform differs from the canonical sequence as follows: 705-738: DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLL → EARQEAAESNRERGQGQEPVGSQEHASTASLTLI 739-909: Missing. | ||||||
| Isoform 3 (identifier: O43184-3) The sequence of this isoform differs from the canonical sequence as follows: 114-116: Missing. 705-738: DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLL → EARQEAAESNRERGQGQEPVGSQEHASTASLTLI 739-909: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O43184-4) The sequence of this isoform differs from the canonical sequence as follows: 114-116: Missing. 705-740: DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLLFT → GKEARQEAAESNRERGQGQEPVGSQEHASTASLTLI 741-909: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 28 | 28 | Potential | ||||||||
| Propeptide | 29 – 207 | 179 | By similarity | PRO_0000029078 | |||||||
| Chain | 208 – 909 | 702 | Disintegrin and metalloproteinase domain-containing protein 12 | PRO_0000029079 | |||||||
Regions | |||||||||||
| Topological domain | 208 – 708 | 501 | Extracellular Potential | ||||||||
| Transmembrane | 709 – 729 | 21 | Potential | ||||||||
| Topological domain | 730 – 909 | 180 | Cytoplasmic Potential | ||||||||
| Domain | 214 – 416 | 203 | Peptidase M12B | ||||||||
| Domain | 424 – 510 | 87 | Disintegrin | ||||||||
| Domain | 656 – 688 | 33 | EGF-like | ||||||||
| Motif | 177 – 184 | 8 | Cysteine switch By similarity | ||||||||
| Motif | 828 – 834 | 7 | SH3-binding; class II By similarity | ||||||||
| Motif | 834 – 841 | 8 | SH3-binding; class I By similarity | ||||||||
| Motif | 885 – 891 | 7 | SH3-binding; class I By similarity | ||||||||
| Compositional bias | 514 – 649 | 136 | Cys-rich | ||||||||
Sites | |||||||||||
| Active site | 351 | 1 | |||||||||
| Metal binding | 179 | 1 | Zinc; in inhibited form By similarity | ||||||||
| Metal binding | 350 | 1 | Zinc; catalytic | ||||||||
| Metal binding | 354 | 1 | Zinc; catalytic | ||||||||
| Metal binding | 360 | 1 | Zinc; catalytic | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 907 | 1 | Phosphotyrosine; by SRC By similarity | ||||||||
| Glycosylation | 111 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 149 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 381 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 452 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 651 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 325 ↔ 411 | By similarity | |||||||||
| Disulfide bond | 367 ↔ 395 | By similarity | |||||||||
| Disulfide bond | 369 ↔ 378 | By similarity | |||||||||
| Disulfide bond | 482 ↔ 502 | By similarity | |||||||||
| Disulfide bond | 660 ↔ 670 | By similarity | |||||||||
| Disulfide bond | 664 ↔ 676 | By similarity | |||||||||
| Disulfide bond | 678 ↔ 687 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 114 – 116 | 3 | Missing in isoform 3 and isoform 4. | VSP_031001 | |||||||
| Alternative sequence | 705 – 740 | 36 | DNQGL…RLLFT → GKEARQEAAESNRERGQGQE PVGSQEHASTASLTLI in isoform 4. | VSP_031002 | |||||||
| Alternative sequence | 705 – 738 | 34 | DNQGL…LIRLL → EARQEAAESNRERGQGQEPV GSQEHASTASLTLI in isoform 2 and isoform 3. | VSP_005476 | |||||||
| Alternative sequence | 739 – 909 | 171 | Missing in isoform 2 and isoform 3. | VSP_005477 | |||||||
| Alternative sequence | 741 – 909 | 169 | Missing in isoform 4. | VSP_031003 | |||||||
| Natural variant | 48 | 1 | G → R: dbSNP rs3740199. Ref.1 Ref.3 Ref.5 Ref.6 | VAR_038542 | |||||||
| Natural variant | 301 | 1 | D → H in a breast cancer sample; somatic mutation. Ref.10 | VAR_036143 | |||||||
| Natural variant | 479 | 1 | G → E in a breast cancer sample; somatic mutation. Ref.10 | VAR_036144 | |||||||
| Natural variant | 792 | 1 | L → F in a breast cancer sample; somatic mutation. Ref.10 | VAR_036145 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel, secreted form of human ADAM 12 (meltrin alpha) provokes myogenesis in vivo." Gilpin B.J., Loechel F., Mattei M.-G., Engvall E., Albrechtsen R., Wewer U.M. J. Biol. Chem. 273:157-166(1998) [PubMed: 9417060] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT ARG-48. Tissue: Placenta. |
| [2] | Gilpin B.J., Loechel F., Mattei M.-G., Engvall E., Albrechtsen R., Wewer U.M. Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO 36. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ARG-48. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-48. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT ARG-48. Tissue: Placenta. |
| [7] | "Human ADAM 12 (meltrin alpha) is an active metalloprotease." Loechel F., Gilpin B.J., Engvall E., Albrechtsen R., Wewer U.M. J. Biol. Chem. 273:16993-16997(1998) [PubMed: 9642263] [Abstract] Cited for: CHARACTERIZATION. |
| [8] | "The cysteine-rich domain of human ADAM 12 supports cell adhesion through syndecans and triggers signaling events that lead to beta1 integrin-dependent cell spreading." Iba K., Albrechtsen R., Gilpin B.J., Froehlich C., Loechel F., Zolkiewska A., Ishiguro K., Kojima T., Liu W., Langford J.K., Sanderson R.D., Brakebusch C., Faessler R., Wewer U.M. J. Cell Biol. 149:1143-1156(2000) [PubMed: 10831617] [Abstract] Cited for: INTERACTION WITH SYNDECANS. |
| [9] | "The adaptor protein fish associates with members of the ADAMs family and localizes to podosomes of Src-transformed cells." Abram C.L., Seals D.F., Pass I., Salinsky D., Maurer L., Roth T.M., Courtneidge S.A. J. Biol. Chem. 278:16844-16851(2003) [PubMed: 12615925] [Abstract] Cited for: INTERACTION WITH SH3PXD2A. |
| [10] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-301; GLU-479 AND PHE-792. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF023476 mRNA. Translation: AAC08702.2. AF023477 mRNA. Translation: AAC08703.2. AY358878 mRNA. Translation: AAQ89237.1. AL589787 AC063963 Genomic DNA. Translation: CAI40682.1. AL589787 AC063963 Genomic DNA. Translation: CAI40683.1. CH471066 Genomic DNA. Translation: EAW49206.1. CH471066 Genomic DNA. Translation: EAW49209.1. BC060804 mRNA. Translation: AAH60804.1. | |
| IPI | IPI00415037. IPI00415038. IPI00743472. IPI00884934. |
| RefSeq | NP_003465.3. NP_067673.2. |
| UniGene | Hs.655388 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1N4Y based on UniProtKB P30403. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | M12.212. |
PTM databases | |
| PhosphoSite | O43184. |
Genome annotation databases | |
| Ensembl | ENSG00000148848. Homo sapiens. [Contig view] |
| GeneID | 8038. |
| KEGG | hsa:8038. |
Organism-specific databases | |
| GeneCards | GC10M127693. |
| H-InvDB | HIX0009299. |
| HGNC | HGNC:190. ADAM12. |
| MIM | 602714. gene. |
| PharmGKB | PA24507. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | O43184. |
| HOVERGEN | O43184. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | syndecan_4_pathway. Syndecan-4-mediated signaling events. |
| Reactome | REACT_9417. Signaling by EGFR. |
Gene expression databases | |
| ArrayExpress | O43184. |
| Bgee | O43184. |
| CleanEx | HS_ADAM12. |
| GermOnline | ENSG00000148848. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006586. ADAM_Cys-rich. IPR001762. Blood-coag_inhib_Disintegrin. IPR018358. Disintegrin_CS. IPR013032. EGF-like_reg_CS. IPR000742. EGF_3. IPR013111. EGF_extracell. IPR006025. Pept_M_Zn_BS. IPR001590. Peptidase_M12B. IPR002870. Peptidase_M12B_N. [Graphical view] |
| Gene3D | G3DSA:4.10.70.10. Blood-coag_inhib_Disintegrin. 1 hit. |
| Pfam | PF08516. ADAM_CR. 1 hit. PF00200. Disintegrin. 1 hit. PF07974. EGF_2. 1 hit. PF01562. Pep_M12B_propep. 1 hit. PF01421. Reprolysin. 1 hit. [Graphical view] |
| PRINTS | PR00289. DISINTEGRIN. |
| ProDom | PD000664. Disintegrin. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00608. ACR. 1 hit. SM00050. DISIN. 1 hit. [Graphical view] |
| PROSITE | PS50215. ADAM_MEPRO. 1 hit. PS00427. DISINTEGRIN_1. 1 hit. PS50214. DISINTEGRIN_2. 1 hit. PS00022. EGF_1. False negative. PS01186. EGF_2. False negative. PS50026. EGF_3. 1 hit. PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 30628. |
| SOURCE | Search... |
Entry information
| Entry name | ADA12_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43184 Secondary accession number(s): O60470 Q6UWB0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


