Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 6

Gene

ARHGAP6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Could regulate the interactions of signaling molecules with the actin cytoskeleton. Promotes continuous elongation of cytoplasmic processes during cell motility and simultaneous retraction of the cell body changing the cell morphology.1 Publication

Miscellaneous

ARHGAP6 gene undergoes X inactivation.

GO - Molecular functioni

  • GTPase activator activity Source: Reactome
  • phospholipase activator activity Source: BHF-UCL
  • phospholipase binding Source: BHF-UCL
  • SH3/SH2 adaptor activity Source: ProtInc
  • SH3 domain binding Source: UniProtKB-KW

GO - Biological processi

  • actin filament polymerization Source: UniProtKB
  • activation of phospholipase C activity Source: BHF-UCL
  • focal adhesion assembly Source: Ensembl
  • negative regulation of focal adhesion assembly Source: BHF-UCL
  • negative regulation of stress fiber assembly Source: BHF-UCL
  • positive regulation of phospholipase activity Source: BHF-UCL
  • regulation of small GTPase mediated signal transduction Source: Reactome
  • Rho protein signal transduction Source: ProtInc

Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

ReactomeiR-HSA-194840. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 6
Alternative name(s):
Rho-type GTPase-activating protein 6
Rho-type GTPase-activating protein RhoGAPX-1
Gene namesi
Name:ARHGAP6
Synonyms:RHOGAP6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:676. ARHGAP6.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: BHF-UCL
  • actin filament Source: UniProtKB
  • cytoplasm Source: BHF-UCL
  • cytosol Source: Reactome

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi395.
OpenTargetsiENSG00000047648.
PharmGKBiPA24960.

Polymorphism and mutation databases

BioMutaiARHGAP6.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000567041 – 974Rho GTPase-activating protein 6Add BLAST974

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei37PhosphoserineBy similarity1
Modified residuei264PhosphoserineCombined sources1
Modified residuei363PhosphoserineCombined sources1
Modified residuei667PhosphoserineCombined sources1
Modified residuei673PhosphoserineCombined sources1
Modified residuei680PhosphoserineCombined sources1
Modified residuei711PhosphoserineCombined sources1
Modified residuei754PhosphoserineCombined sources1
Modified residuei772PhosphoserineCombined sources1
Modified residuei777PhosphoserineCombined sources1
Modified residuei786PhosphoserineCombined sources1
Modified residuei820PhosphoserineCombined sources1
Modified residuei928PhosphoserineCombined sources1
Modified residuei931PhosphoserineCombined sources1
Modified residuei939PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO43182.
PaxDbiO43182.
PeptideAtlasiO43182.
PRIDEiO43182.
TopDownProteomicsiO43182-5. [O43182-5]

PTM databases

iPTMnetiO43182.
PhosphoSitePlusiO43182.

Expressioni

Tissue specificityi

Highly expressed in kidney, heart and skeletal muscle followed by retina, lymphoblast, placenta, lung, brain, pancreas and liver.

Gene expression databases

BgeeiENSG00000047648.
CleanExiHS_ARHGAP6.
ExpressionAtlasiO43182. baseline and differential.
GenevisibleiO43182. HS.

Organism-specific databases

HPAiHPA036779.
HPA064390.

Interactioni

GO - Molecular functioni

  • phospholipase binding Source: BHF-UCL
  • SH3/SH2 adaptor activity Source: ProtInc
  • SH3 domain binding Source: UniProtKB-KW

Protein-protein interaction databases

BioGridi106888. 1 interactor.
STRINGi9606.ENSP00000338967.

Structurei

3D structure databases

ProteinModelPortaliO43182.
SMRiO43182.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini401 – 602Rho-GAPPROSITE-ProRule annotationAdd BLAST202

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi342 – 352SH3-bindingAdd BLAST11

Keywords - Domaini

SH3-binding

Phylogenomic databases

eggNOGiKOG2710. Eukaryota.
ENOG410YVI5. LUCA.
GeneTreeiENSGT00760000119123.
HOGENOMiHOG000231644.
HOVERGENiHBG067762.
InParanoidiO43182.
KOiK20631.
OrthoDBiEOG091G0849.
PhylomeDBiO43182.
TreeFamiTF316710.

Family and domain databases

InterProiView protein in InterPro
IPR008936. Rho_GTPase_activation_prot.
IPR030772. RhoGAP6.
IPR000198. RhoGAP_dom.
PANTHERiPTHR12635:SF11. PTHR12635:SF11. 1 hit.
PfamiView protein in Pfam
PF00620. RhoGAP. 1 hit.
SMARTiView protein in SMART
SM00324. RhoGAP. 1 hit.
SUPFAMiSSF48350. SSF48350. 1 hit.
PROSITEiView protein in PROSITE
PS50238. RHOGAP. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: O43182-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAQSLLHSV FSCSSPASSS AASAKGFSKR KLRQTRSLDP ALIGGCGSDE
60 70 80 90 100
AGAEGSARGA TAGRLYSPSL PAESLGPRLA SSSRGPPPRA TRLPPPGPLC
110 120 130 140 150
SSFSTPSTPQ EKSPSGSFHF DYEVPLGRGG LKKSMAWDLP SVLAGPASSR
160 170 180 190 200
SASSILCSSG GGPNGIFASP RRWLQQRKFQ SPPDSRGHPY VVWKSEGDFT
210 220 230 240 250
WNSMSGRSVR LRSVPIQSLS ELERARLQEV AFYQLQQDCD LSCQITIPKD
260 270 280 290 300
GQKRKKSLRK KLDSLGKEKN KDKEFIPQAF GMPLSQVIAN DRAYKLKQDL
310 320 330 340 350
QRDEQKDASD FVASLLPFGN KRQNKELSSS NSSLSSTSET PNESTSPNTP
360 370 380 390 400
EPAPRARRRG AMSVDSITDL DDNQSRLLEA LQLSLPAEAQ SKKEKARDKK
410 420 430 440 450
LSLNPIYRQV PRLVDSCCQH LEKHGLQTVG IFRVGSSKKR VRQLREEFDR
460 470 480 490 500
GIDVSLEEEH SVHDVAALLK EFLRDMPDPL LTRELYTAFI NTLLLEPEEQ
510 520 530 540 550
LGTLQLLIYL LPPCNCDTLH RLLQFLSIVA RHADDNISKD GQEVTGNKMT
560 570 580 590 600
SLNLATIFGP NLLHKQKSSD KEFSVQSSAR AEESTAIIAV VQKMIENYEA
610 620 630 640 650
LFMVPPDLQN EVLISLLETD PDVVDYLLRR KASQSSSPDM LQSEVSFSVG
660 670 680 690 700
GRHSSTDSNK ASSGDISPYD NNSPVLSERS LLAMQEDAAP GGSEKLYRVP
710 720 730 740 750
GQFMLVGHLS SSKSRESSPG PRLGKDLSEE PFDIWGTWHS TLKSGSKDPG
760 770 780 790 800
MTGSSGDIFE SSSLRAGPCS LSQGNLSPNW PRWQGSPAEL DSDTQGARRT
810 820 830 840 850
QAAAPATEGR AHPAVSRACS TPHVQVAGKA ERPTARSEQY LTLSGAHDLS
860 870 880 890 900
ESELDVAGLQ SRATPQCQRP HGSGRDDKRP PPPYPGPGKP AAAAAWIQGP
910 920 930 940 950
PEGVETPTDQ GGQAAEREQQ VTQKKLSSAN SLPAGEQDSP RLGDAGWLDW
960 970
QRERWQIWEL LSTDNPDALP ETLV
Length:974
Mass (Da):105,947
Last modified:October 3, 2006 - v3
Checksum:iBEE22EB54F019E30
GO
Isoform 1 (identifier: O43182-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     726-765: DLSEEPFDIW...GDIFESSSLR → GNWSLASRRW...SSSLPYLMFL
     766-974: Missing.

Show »
Length:765
Mass (Da):83,926
Checksum:i992B50A957E7019E
GO
Isoform 2 (identifier: O43182-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-196: E → ELELYDLQILGTKPPMNSDTHRNFDPTATLRNQ
     637-658: SPDMLQSEVSFSVGGRHSSTDS → TSSVLPAAVQACPQYPASMFTP
     659-974: Missing.

Show »
Length:690
Mass (Da):75,918
Checksum:iEE1801C208E48DB9
GO
Isoform 4 (identifier: O43182-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.

Show »
Length:771
Mass (Da):84,844
Checksum:iA7CAEADB29590AAF
GO
Isoform 5 (identifier: O43182-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.
     726-765: DLSEEPFDIW...GDIFESSSLR → GNWSLASRRW...SSSLPYLMFL
     766-974: Missing.

Show »
Length:562
Mass (Da):62,822
Checksum:i96707FB1D7CBFC62
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti231A → P in AAF43261 (PubMed:10699171).Curated1
Sequence conflicti231A → P in AAD55087 (PubMed:10699171).Curated1
Sequence conflicti231A → P in AAC98539 (PubMed:9417914).Curated1
Sequence conflicti231A → P in AAC98540 (PubMed:9417914).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024453791D → E1 PublicationCorresponds to variant dbSNP:rs1009758Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0016371 – 203Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST203
Alternative sequenceiVSP_001638196E → ELELYDLQILGTKPPMNSDT HRNFDPTATLRNQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_001639637 – 658SPDML…SSTDS → TSSVLPAAVQACPQYPASMF TP in isoform 2. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_001640659 – 974Missing in isoform 2. 1 PublicationAdd BLAST316
Alternative sequenceiVSP_001641726 – 765DLSEE…SSSLR → GNWSLASRRWPKQATLLLLH VAWCGALRTFSSSLPYLMFL in isoform 1 and isoform 5. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_001642766 – 974Missing in isoform 1 and isoform 5. 2 PublicationsAdd BLAST209

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF117067 mRNA. Translation: AAF43261.1.
AF177663 mRNA. Translation: AAD53166.1.
AF177665 mRNA. Translation: AAD55087.1.
AF012272 mRNA. Translation: AAC98539.2.
AF022212 mRNA. Translation: AAC98540.2.
BC150635 mRNA. Translation: AAI50636.1.
CCDSiCCDS14140.1. [O43182-1]
CCDS14141.1. [O43182-4]
CCDS14142.1. [O43182-2]
PIRiE59434.
RefSeqiNP_001274171.1. NM_001287242.1.
NP_006116.2. NM_006125.2. [O43182-2]
NP_038267.1. NM_013423.2. [O43182-4]
NP_038286.2. NM_013427.2. [O43182-1]
UniGeneiHs.435291.

Genome annotation databases

EnsembliENST00000303025; ENSP00000302312; ENSG00000047648. [O43182-4]
ENST00000337414; ENSP00000338967; ENSG00000047648. [O43182-1]
ENST00000380718; ENSP00000370094; ENSG00000047648. [O43182-2]
ENST00000380736; ENSP00000370112; ENSG00000047648. [O43182-4]
ENST00000495242; ENSP00000435767; ENSG00000047648. [O43182-3]
GeneIDi395.
KEGGihsa:395.
UCSCiuc004cum.2. human. [O43182-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiRHG06_HUMAN
AccessioniPrimary (citable) accession number: O43182
Secondary accession number(s): B2RWQ0
, O43437, Q9P1B3, Q9UK81, Q9UK82
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: October 3, 2006
Last modified: May 10, 2017
This is version 157 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot