Reviewed,
UniProtKB/Swiss-Prot O43182 (RHG06_HUMAN)
Last modified
June 16, 2009.
Version 88.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Rho GTPase-activating protein 6 Alternative name(s): Rho-type GTPase-activating protein 6 Rho-type GTPase-activating protein RhoGAPX-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 974 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Could regulate the interactions of signaling molecules with the actin cytoskeleton. Promotes continuous elongation of cytoplasmic processes during cell motility and simultaneous retraction of the cell body changing the cell morphology. Ref.1 |
| Subcellular location | |
| Tissue specificity | Highly expressed in kidney, heart and skeletal muscle followed by retina, lymphoblast, placenta, lung, brain, pancreas and liver. |
| Miscellaneous | ARHGAP6 gene undergoes X inactivation. |
| Sequence similarities | Contains 1 Rho-GAP domain. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3 (identifier: O43182-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: O43182-2) The sequence of this isoform differs from the canonical sequence as follows: 726-765: DLSEEPFDIW...GDIFESSSLR → GNWSLASRRW...SSSLPYLMFL 766-974: Missing. | ||||||
| Isoform 2 (identifier: O43182-3) The sequence of this isoform differs from the canonical sequence as follows: 196-196: E → ELELYDLQILGTKPPMNSDTHRNFDPTATLRNQ 637-658: SPDMLQSEVSFSVGGRHSSTDS → TSSVLPAAVQACPQYPASMFTP 659-974: Missing. | ||||||
| Isoform 4 (identifier: O43182-4) The sequence of this isoform differs from the canonical sequence as follows: 1-203: Missing. | ||||||
| Isoform 5 (identifier: O43182-5) The sequence of this isoform differs from the canonical sequence as follows: 1-203: Missing. 726-765: DLSEEPFDIW...GDIFESSSLR → GNWSLASRRW...SSSLPYLMFL 766-974: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 974 | 974 | Rho GTPase-activating protein 6 | PRO_0000056704 | |||||
Regions | |||||||||
| Domain | 401 – 602 | 202 | Rho-GAP | ||||||
| Motif | 342 – 352 | 11 | SH3-binding | ||||||
Amino acid modifications | |||||||||
| Modified residue | 264 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 663 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 673 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 754 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 777 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 928 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 939 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 203 | 203 | Missing in isoform 4 and isoform 5. | VSP_001637 | |||||
| Alternative sequence | 196 | 1 | E → ELELYDLQILGTKPPMNSDT HRNFDPTATLRNQ in isoform 2. | VSP_001638 | |||||
| Alternative sequence | 637 – 658 | 22 | SPDML…SSTDS → TSSVLPAAVQACPQYPASMF TP in isoform 2. | VSP_001639 | |||||
| Alternative sequence | 659 – 974 | 316 | Missing in isoform 2. | VSP_001640 | |||||
| Alternative sequence | 726 – 765 | 40 | DLSEE…SSSLR → GNWSLASRRWPKQATLLLLH VAWCGALRTFSSSLPYLMFL in isoform 1 and isoform 5. | VSP_001641 | |||||
| Alternative sequence | 766 – 974 | 209 | Missing in isoform 1 and isoform 5. | VSP_001642 | |||||
| Natural variant | 791 | 1 | D → E: dbSNP rs1009758. Ref.3 | VAR_024453 | |||||
Experimental info | |||||||||
| Sequence conflict | 231 | 1 | A → P in AAF43261. Ref.1 | ||||||
| Sequence conflict | 231 | 1 | A → P in AAD55087. Ref.1 | ||||||
| Sequence conflict | 231 | 1 | A → P Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Functional analysis of ARHGAP6, a novel GTPase-activating protein for RhoA." Prakash S.K., Paylor R., Jenna S., Lamarche-Vane N., Armstrong D.L., Xu B., Mancini M.A., Zoghbi H.Y. Hum. Mol. Genet. 9:477-488(2000) [PubMed: 10699171] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4 AND 5), SEQUENCE REVISION, FUNCTION, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING. Tissue: Fetal kidney. |
| [2] | "Cloning and characterization of a novel rho-type GTPase-activating protein gene (ARHGAP6) from the critical region for microphthalmia with linear skin defects." Schaefer L., Prakash S.K., Zoghbi H.Y. Genomics 46:268-277(1997) [PubMed: 9417914] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT GLU-791. |
| [4] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-264; SER-663; SER-673; SER-754; SER-777; SER-928 AND SER-939, MASS SPECTROMETRY. Tissue: Platelet. |
| [5] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF117067 mRNA. Translation: AAF43261.1. AF177663 mRNA. Translation: AAD53166.1. AF177665 mRNA. Translation: AAD55087.1. AF012272 mRNA. Translation: AAC98539.2. AF022212 mRNA. Translation: AAC98540.2. BC150635 mRNA. Translation: AAI50636.1. | |
| IPI | IPI00011219. IPI00221121. IPI00221122. IPI00221123. IPI00872679. |
| PIR | E59434. |
| RefSeq | NP_006116.2. NP_038267.1. NP_038286.2. |
| UniGene | Hs.435291 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1F7C based on UniProtKB Q98935. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | O43182. |
Proteomic databases | |
| PRIDE | O43182. |
Genome annotation databases | |
| Ensembl | ENSG00000047648. Homo sapiens. [Contig view] |
| GeneID | 395. |
| KEGG | hsa:395. |
Organism-specific databases | |
| GeneCards | GC0XM011065. |
| H-InvDB | HIX0056117. |
| HGNC | HGNC:676. ARHGAP6. |
| MIM | 300118. gene. |
| PharmGKB | PA24960. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | O43182. |
| HOVERGEN | O43182. |
| OMA | O43182. GHLPSSK. |
Enzyme and pathway databases | |
| Reactome | REACT_11044. Signaling by Rho GTPases. |
Gene expression databases | |
| ArrayExpress | O43182. |
| Bgee | O43182. |
| CleanEx | HS_ARHGAP6. |
| GermOnline | ENSG00000047648. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000198. RhoGAP. [Graphical view] |
| Gene3D | G3DSA:1.10.555.10. RhoGAP. 1 hit. |
| Pfam | PF00620. RhoGAP. 1 hit. [Graphical view] |
| SMART | SM00324. RhoGAP. 1 hit. [Graphical view] |
| PROSITE | PS50238. RHOGAP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 1649. |
| SOURCE | Search... |
Entry information
| Entry name | RHG06_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43182 Secondary accession number(s): B2RWQ0 Q9UK82 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


