SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O43182

- RHG06_HUMAN

UniProt

O43182 - RHG06_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Rho GTPase-activating protein 6
Gene
ARHGAP6, RHOGAP6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Could regulate the interactions of signaling molecules with the actin cytoskeleton. Promotes continuous elongation of cytoplasmic processes during cell motility and simultaneous retraction of the cell body changing the cell morphology.1 Publication

GO - Molecular functioni

  1. Rho GTPase activator activity Source: BHF-UCL
  2. SH3/SH2 adaptor activity Source: ProtInc
  3. phospholipase activator activity Source: BHF-UCL
  4. phospholipase binding Source: BHF-UCL

GO - Biological processi

  1. Rho protein signal transduction Source: UniProtKB
  2. actin filament polymerization Source: UniProtKB
  3. activation of phospholipase C activity Source: BHF-UCL
  4. focal adhesion assembly Source: Ensembl
  5. negative regulation of focal adhesion assembly Source: BHF-UCL
  6. negative regulation of stress fiber assembly Source: BHF-UCL
  7. positive regulation of phospholipase activity Source: BHF-UCL
  8. positive regulation of signal transduction Source: GOC
  9. regulation of GTPase activity Source: BHF-UCL
  10. regulation of small GTPase mediated signal transduction Source: Reactome
  11. small GTPase mediated signal transduction Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 6
Alternative name(s):
Rho-type GTPase-activating protein 6
Rho-type GTPase-activating protein RhoGAPX-1
Gene namesi
Name:ARHGAP6
Synonyms:RHOGAP6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:676. ARHGAP6.

Subcellular locationi

Cytoplasm 1 Publication

GO - Cellular componenti

  1. actin cytoskeleton Source: BHF-UCL
  2. actin filament Source: UniProtKB
  3. cytoplasm Source: BHF-UCL
  4. cytosol Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA24960.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 974974Rho GTPase-activating protein 6
PRO_0000056704Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei264 – 2641Phosphoserine1 Publication
Modified residuei673 – 6731Phosphoserine1 Publication
Modified residuei777 – 7771Phosphoserine1 Publication
Modified residuei939 – 9391Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO43182.
PaxDbiO43182.
PRIDEiO43182.

PTM databases

PhosphoSiteiO43182.

Expressioni

Tissue specificityi

Highly expressed in kidney, heart and skeletal muscle followed by retina, lymphoblast, placenta, lung, brain, pancreas and liver.

Gene expression databases

ArrayExpressiO43182.
BgeeiO43182.
CleanExiHS_ARHGAP6.
GenevestigatoriO43182.

Organism-specific databases

HPAiHPA036779.

Interactioni

Protein-protein interaction databases

BioGridi106888. 1 interaction.
STRINGi9606.ENSP00000338967.

Structurei

3D structure databases

ProteinModelPortaliO43182.
SMRiO43182. Positions 404-605.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini401 – 602202Rho-GAP
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi342 – 35211SH3-binding
Add
BLAST

Sequence similaritiesi

Contains 1 Rho-GAP domain.

Keywords - Domaini

SH3-binding

Phylogenomic databases

eggNOGiNOG276736.
HOGENOMiHOG000231644.
HOVERGENiHBG067762.
InParanoidiO43182.
OMAiLRLFKQC.
OrthoDBiEOG7FJH1S.
PhylomeDBiO43182.
TreeFamiTF316710.

Family and domain databases

Gene3Di1.10.555.10. 2 hits.
InterProiIPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
PROSITEiPS50238. RHOGAP. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 3 (identifier: O43182-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSAQSLLHSV FSCSSPASSS AASAKGFSKR KLRQTRSLDP ALIGGCGSDE    50
AGAEGSARGA TAGRLYSPSL PAESLGPRLA SSSRGPPPRA TRLPPPGPLC 100
SSFSTPSTPQ EKSPSGSFHF DYEVPLGRGG LKKSMAWDLP SVLAGPASSR 150
SASSILCSSG GGPNGIFASP RRWLQQRKFQ SPPDSRGHPY VVWKSEGDFT 200
WNSMSGRSVR LRSVPIQSLS ELERARLQEV AFYQLQQDCD LSCQITIPKD 250
GQKRKKSLRK KLDSLGKEKN KDKEFIPQAF GMPLSQVIAN DRAYKLKQDL 300
QRDEQKDASD FVASLLPFGN KRQNKELSSS NSSLSSTSET PNESTSPNTP 350
EPAPRARRRG AMSVDSITDL DDNQSRLLEA LQLSLPAEAQ SKKEKARDKK 400
LSLNPIYRQV PRLVDSCCQH LEKHGLQTVG IFRVGSSKKR VRQLREEFDR 450
GIDVSLEEEH SVHDVAALLK EFLRDMPDPL LTRELYTAFI NTLLLEPEEQ 500
LGTLQLLIYL LPPCNCDTLH RLLQFLSIVA RHADDNISKD GQEVTGNKMT 550
SLNLATIFGP NLLHKQKSSD KEFSVQSSAR AEESTAIIAV VQKMIENYEA 600
LFMVPPDLQN EVLISLLETD PDVVDYLLRR KASQSSSPDM LQSEVSFSVG 650
GRHSSTDSNK ASSGDISPYD NNSPVLSERS LLAMQEDAAP GGSEKLYRVP 700
GQFMLVGHLS SSKSRESSPG PRLGKDLSEE PFDIWGTWHS TLKSGSKDPG 750
MTGSSGDIFE SSSLRAGPCS LSQGNLSPNW PRWQGSPAEL DSDTQGARRT 800
QAAAPATEGR AHPAVSRACS TPHVQVAGKA ERPTARSEQY LTLSGAHDLS 850
ESELDVAGLQ SRATPQCQRP HGSGRDDKRP PPPYPGPGKP AAAAAWIQGP 900
PEGVETPTDQ GGQAAEREQQ VTQKKLSSAN SLPAGEQDSP RLGDAGWLDW 950
QRERWQIWEL LSTDNPDALP ETLV 974
Length:974
Mass (Da):105,947
Last modified:October 3, 2006 - v3
Checksum:iBEE22EB54F019E30
GO
Isoform 1 (identifier: O43182-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     726-765: DLSEEPFDIW...GDIFESSSLR → GNWSLASRRW...SSSLPYLMFL
     766-974: Missing.

Show »
Length:765
Mass (Da):83,926
Checksum:i992B50A957E7019E
GO
Isoform 2 (identifier: O43182-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-196: E → ELELYDLQILGTKPPMNSDTHRNFDPTATLRNQ
     637-658: SPDMLQSEVSFSVGGRHSSTDS → TSSVLPAAVQACPQYPASMFTP
     659-974: Missing.

Show »
Length:690
Mass (Da):75,918
Checksum:iEE1801C208E48DB9
GO
Isoform 4 (identifier: O43182-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.

Show »
Length:771
Mass (Da):84,844
Checksum:iA7CAEADB29590AAF
GO
Isoform 5 (identifier: O43182-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.
     726-765: DLSEEPFDIW...GDIFESSSLR → GNWSLASRRW...SSSLPYLMFL
     766-974: Missing.

Show »
Length:562
Mass (Da):62,822
Checksum:i96707FB1D7CBFC62
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti791 – 7911D → E.1 Publication
Corresponds to variant rs1009758 [ dbSNP | Ensembl ].
VAR_024453

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 203203Missing in isoform 4 and isoform 5.
VSP_001637Add
BLAST
Alternative sequencei196 – 1961E → ELELYDLQILGTKPPMNSDT HRNFDPTATLRNQ in isoform 2.
VSP_001638
Alternative sequencei637 – 65822SPDML…SSTDS → TSSVLPAAVQACPQYPASMF TP in isoform 2.
VSP_001639Add
BLAST
Alternative sequencei659 – 974316Missing in isoform 2.
VSP_001640Add
BLAST
Alternative sequencei726 – 76540DLSEE…SSSLR → GNWSLASRRWPKQATLLLLH VAWCGALRTFSSSLPYLMFL in isoform 1 and isoform 5.
VSP_001641Add
BLAST
Alternative sequencei766 – 974209Missing in isoform 1 and isoform 5.
VSP_001642Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti231 – 2311A → P in AAF43261. 1 Publication
Sequence conflicti231 – 2311A → P in AAD55087. 1 Publication
Sequence conflicti231 – 2311A → P in AAC98539. 1 Publication
Sequence conflicti231 – 2311A → P in AAC98540. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF117067 mRNA. Translation: AAF43261.1.
AF177663 mRNA. Translation: AAD53166.1.
AF177665 mRNA. Translation: AAD55087.1.
AF012272 mRNA. Translation: AAC98539.2.
AF022212 mRNA. Translation: AAC98540.2.
BC150635 mRNA. Translation: AAI50636.1.
CCDSiCCDS14140.1. [O43182-1]
CCDS14141.1. [O43182-4]
CCDS14142.1. [O43182-2]
PIRiE59434.
RefSeqiNP_001274171.1. NM_001287242.1.
NP_006116.2. NM_006125.2. [O43182-2]
NP_038267.1. NM_013423.2. [O43182-4]
NP_038286.2. NM_013427.2. [O43182-1]
UniGeneiHs.435291.

Genome annotation databases

EnsembliENST00000303025; ENSP00000302312; ENSG00000047648. [O43182-4]
ENST00000337414; ENSP00000338967; ENSG00000047648. [O43182-1]
ENST00000380718; ENSP00000370094; ENSG00000047648. [O43182-2]
ENST00000380732; ENSP00000370108; ENSG00000047648. [O43182-3]
ENST00000380736; ENSP00000370112; ENSG00000047648. [O43182-4]
ENST00000495242; ENSP00000435767; ENSG00000047648. [O43182-3]
GeneIDi395.
KEGGihsa:395.
UCSCiuc004cum.1. human. [O43182-1]
uc004cur.1. human. [O43182-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF117067 mRNA. Translation: AAF43261.1 .
AF177663 mRNA. Translation: AAD53166.1 .
AF177665 mRNA. Translation: AAD55087.1 .
AF012272 mRNA. Translation: AAC98539.2 .
AF022212 mRNA. Translation: AAC98540.2 .
BC150635 mRNA. Translation: AAI50636.1 .
CCDSi CCDS14140.1. [O43182-1 ]
CCDS14141.1. [O43182-4 ]
CCDS14142.1. [O43182-2 ]
PIRi E59434.
RefSeqi NP_001274171.1. NM_001287242.1.
NP_006116.2. NM_006125.2. [O43182-2 ]
NP_038267.1. NM_013423.2. [O43182-4 ]
NP_038286.2. NM_013427.2. [O43182-1 ]
UniGenei Hs.435291.

3D structure databases

ProteinModelPortali O43182.
SMRi O43182. Positions 404-605.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 106888. 1 interaction.
STRINGi 9606.ENSP00000338967.

PTM databases

PhosphoSitei O43182.

Proteomic databases

MaxQBi O43182.
PaxDbi O43182.
PRIDEi O43182.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000303025 ; ENSP00000302312 ; ENSG00000047648 . [O43182-4 ]
ENST00000337414 ; ENSP00000338967 ; ENSG00000047648 . [O43182-1 ]
ENST00000380718 ; ENSP00000370094 ; ENSG00000047648 . [O43182-2 ]
ENST00000380732 ; ENSP00000370108 ; ENSG00000047648 . [O43182-3 ]
ENST00000380736 ; ENSP00000370112 ; ENSG00000047648 . [O43182-4 ]
ENST00000495242 ; ENSP00000435767 ; ENSG00000047648 . [O43182-3 ]
GeneIDi 395.
KEGGi hsa:395.
UCSCi uc004cum.1. human. [O43182-1 ]
uc004cur.1. human. [O43182-2 ]

Organism-specific databases

CTDi 395.
GeneCardsi GC0XM011155.
HGNCi HGNC:676. ARHGAP6.
HPAi HPA036779.
MIMi 300118. gene.
neXtProti NX_O43182.
PharmGKBi PA24960.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG276736.
HOGENOMi HOG000231644.
HOVERGENi HBG067762.
InParanoidi O43182.
OMAi LRLFKQC.
OrthoDBi EOG7FJH1S.
PhylomeDBi O43182.
TreeFami TF316710.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.

Miscellaneous databases

GenomeRNAii 395.
NextBioi 1649.
PROi O43182.
SOURCEi Search...

Gene expression databases

ArrayExpressi O43182.
Bgeei O43182.
CleanExi HS_ARHGAP6.
Genevestigatori O43182.

Family and domain databases

Gene3Di 1.10.555.10. 2 hits.
InterProi IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view ]
Pfami PF00620. RhoGAP. 1 hit.
[Graphical view ]
SMARTi SM00324. RhoGAP. 1 hit.
[Graphical view ]
SUPFAMi SSF48350. SSF48350. 1 hit.
PROSITEi PS50238. RHOGAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Functional analysis of ARHGAP6, a novel GTPase-activating protein for RhoA."
    Prakash S.K., Paylor R., Jenna S., Lamarche-Vane N., Armstrong D.L., Xu B., Mancini M.A., Zoghbi H.Y.
    Hum. Mol. Genet. 9:477-488(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4 AND 5), SEQUENCE REVISION, FUNCTION, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
    Tissue: Fetal kidney.
  2. "Cloning and characterization of a novel rho-type GTPase-activating protein gene (ARHGAP6) from the critical region for microphthalmia with linear skin defects."
    Schaefer L., Prakash S.K., Zoghbi H.Y.
    Genomics 46:268-277(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT GLU-791.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-264; SER-673; SER-777 AND SER-939, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Platelet.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRHG06_HUMAN
AccessioniPrimary (citable) accession number: O43182
Secondary accession number(s): B2RWQ0
, O43437, Q9P1B3, Q9UK81, Q9UK82
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: October 3, 2006
Last modified: September 3, 2014
This is version 136 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

ARHGAP6 gene undergoes X inactivation.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi