Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O43182 (RHG06_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 135. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Rho GTPase-activating protein 6
Alternative name(s):
Rho-type GTPase-activating protein 6
Rho-type GTPase-activating protein RhoGAPX-1
Gene names
Name:ARHGAP6
Synonyms:RHOGAP6
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length974 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Could regulate the interactions of signaling molecules with the actin cytoskeleton. Promotes continuous elongation of cytoplasmic processes during cell motility and simultaneous retraction of the cell body changing the cell morphology. Ref.1

Subcellular location

Cytoplasm Ref.1.

Tissue specificity

Highly expressed in kidney, heart and skeletal muscle followed by retina, lymphoblast, placenta, lung, brain, pancreas and liver.

Miscellaneous

ARHGAP6 gene undergoes X inactivation.

Sequence similarities

Contains 1 Rho-GAP domain.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSH3-binding
   Molecular functionGTPase activation
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processRho protein signal transduction

Non-traceable author statement Ref.1. Source: UniProtKB

actin filament polymerization

Non-traceable author statement Ref.1. Source: UniProtKB

activation of phospholipase C activity

Inferred from direct assay PubMed 18434237. Source: BHF-UCL

focal adhesion assembly

Inferred from electronic annotation. Source: Ensembl

negative regulation of focal adhesion assembly

Inferred from mutant phenotype Ref.1. Source: BHF-UCL

negative regulation of stress fiber assembly

Inferred from mutant phenotype Ref.1. Source: BHF-UCL

positive regulation of phospholipase activity

Inferred from direct assay PubMed 18434237. Source: BHF-UCL

positive regulation of signal transduction

Traceable author statement PubMed 8570618. Source: GOC

regulation of GTPase activity

Inferred from sequence or structural similarity Ref.1. Source: BHF-UCL

regulation of small GTPase mediated signal transduction

Traceable author statement. Source: Reactome

small GTPase mediated signal transduction

Traceable author statement. Source: Reactome

   Cellular_componentactin cytoskeleton

Inferred from sequence or structural similarity Ref.1. Source: BHF-UCL

actin filament

Non-traceable author statement Ref.1. Source: UniProtKB

cytoplasm

Inferred from mutant phenotype Ref.1. Source: BHF-UCL

cytosol

Traceable author statement. Source: Reactome

   Molecular_functionRho GTPase activator activity

Inferred from sequence or structural similarity Ref.1. Source: BHF-UCL

SH3/SH2 adaptor activity

Traceable author statement PubMed 8570618. Source: ProtInc

phospholipase activator activity

Inferred from direct assay PubMed 18434237. Source: BHF-UCL

phospholipase binding

Inferred from physical interaction PubMed 18434237. Source: BHF-UCL

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 3 (identifier: O43182-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 (identifier: O43182-2)

The sequence of this isoform differs from the canonical sequence as follows:
     726-765: DLSEEPFDIW...GDIFESSSLR → GNWSLASRRW...SSSLPYLMFL
     766-974: Missing.
Isoform 2 (identifier: O43182-3)

The sequence of this isoform differs from the canonical sequence as follows:
     196-196: E → ELELYDLQILGTKPPMNSDTHRNFDPTATLRNQ
     637-658: SPDMLQSEVSFSVGGRHSSTDS → TSSVLPAAVQACPQYPASMFTP
     659-974: Missing.
Isoform 4 (identifier: O43182-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.
Isoform 5 (identifier: O43182-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.
     726-765: DLSEEPFDIW...GDIFESSSLR → GNWSLASRRW...SSSLPYLMFL
     766-974: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 974974Rho GTPase-activating protein 6
PRO_0000056704

Regions

Domain401 – 602202Rho-GAP
Motif342 – 35211SH3-binding

Amino acid modifications

Modified residue2641Phosphoserine Ref.4
Modified residue6731Phosphoserine Ref.4
Modified residue7771Phosphoserine Ref.4
Modified residue9391Phosphoserine Ref.4

Natural variations

Alternative sequence1 – 203203Missing in isoform 4 and isoform 5.
VSP_001637
Alternative sequence1961E → ELELYDLQILGTKPPMNSDT HRNFDPTATLRNQ in isoform 2.
VSP_001638
Alternative sequence637 – 65822SPDML…SSTDS → TSSVLPAAVQACPQYPASMF TP in isoform 2.
VSP_001639
Alternative sequence659 – 974316Missing in isoform 2.
VSP_001640
Alternative sequence726 – 76540DLSEE…SSSLR → GNWSLASRRWPKQATLLLLH VAWCGALRTFSSSLPYLMFL in isoform 1 and isoform 5.
VSP_001641
Alternative sequence766 – 974209Missing in isoform 1 and isoform 5.
VSP_001642
Natural variant7911D → E. Ref.3
Corresponds to variant rs1009758 [ dbSNP | Ensembl ].
VAR_024453

Experimental info

Sequence conflict2311A → P in AAF43261. Ref.1
Sequence conflict2311A → P in AAD55087. Ref.1
Sequence conflict2311A → P in AAC98539. Ref.2
Sequence conflict2311A → P in AAC98540. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 3 [UniParc].

Last modified October 3, 2006. Version 3.
Checksum: BEE22EB54F019E30

FASTA974105,947
        10         20         30         40         50         60 
MSAQSLLHSV FSCSSPASSS AASAKGFSKR KLRQTRSLDP ALIGGCGSDE AGAEGSARGA 

        70         80         90        100        110        120 
TAGRLYSPSL PAESLGPRLA SSSRGPPPRA TRLPPPGPLC SSFSTPSTPQ EKSPSGSFHF 

       130        140        150        160        170        180 
DYEVPLGRGG LKKSMAWDLP SVLAGPASSR SASSILCSSG GGPNGIFASP RRWLQQRKFQ 

       190        200        210        220        230        240 
SPPDSRGHPY VVWKSEGDFT WNSMSGRSVR LRSVPIQSLS ELERARLQEV AFYQLQQDCD 

       250        260        270        280        290        300 
LSCQITIPKD GQKRKKSLRK KLDSLGKEKN KDKEFIPQAF GMPLSQVIAN DRAYKLKQDL 

       310        320        330        340        350        360 
QRDEQKDASD FVASLLPFGN KRQNKELSSS NSSLSSTSET PNESTSPNTP EPAPRARRRG 

       370        380        390        400        410        420 
AMSVDSITDL DDNQSRLLEA LQLSLPAEAQ SKKEKARDKK LSLNPIYRQV PRLVDSCCQH 

       430        440        450        460        470        480 
LEKHGLQTVG IFRVGSSKKR VRQLREEFDR GIDVSLEEEH SVHDVAALLK EFLRDMPDPL 

       490        500        510        520        530        540 
LTRELYTAFI NTLLLEPEEQ LGTLQLLIYL LPPCNCDTLH RLLQFLSIVA RHADDNISKD 

       550        560        570        580        590        600 
GQEVTGNKMT SLNLATIFGP NLLHKQKSSD KEFSVQSSAR AEESTAIIAV VQKMIENYEA 

       610        620        630        640        650        660 
LFMVPPDLQN EVLISLLETD PDVVDYLLRR KASQSSSPDM LQSEVSFSVG GRHSSTDSNK 

       670        680        690        700        710        720 
ASSGDISPYD NNSPVLSERS LLAMQEDAAP GGSEKLYRVP GQFMLVGHLS SSKSRESSPG 

       730        740        750        760        770        780 
PRLGKDLSEE PFDIWGTWHS TLKSGSKDPG MTGSSGDIFE SSSLRAGPCS LSQGNLSPNW 

       790        800        810        820        830        840 
PRWQGSPAEL DSDTQGARRT QAAAPATEGR AHPAVSRACS TPHVQVAGKA ERPTARSEQY 

       850        860        870        880        890        900 
LTLSGAHDLS ESELDVAGLQ SRATPQCQRP HGSGRDDKRP PPPYPGPGKP AAAAAWIQGP 

       910        920        930        940        950        960 
PEGVETPTDQ GGQAAEREQQ VTQKKLSSAN SLPAGEQDSP RLGDAGWLDW QRERWQIWEL 

       970 
LSTDNPDALP ETLV 

« Hide

Isoform 1 [UniParc].

Checksum: 992B50A957E7019E
Show »

FASTA76583,926
Isoform 2 [UniParc].

Checksum: EE1801C208E48DB9
Show »

FASTA69075,918
Isoform 4 [UniParc].

Checksum: A7CAEADB29590AAF
Show »

FASTA77184,844
Isoform 5 [UniParc].

Checksum: 96707FB1D7CBFC62
Show »

FASTA56262,822

References

« Hide 'large scale' references
[1]"Functional analysis of ARHGAP6, a novel GTPase-activating protein for RhoA."
Prakash S.K., Paylor R., Jenna S., Lamarche-Vane N., Armstrong D.L., Xu B., Mancini M.A., Zoghbi H.Y.
Hum. Mol. Genet. 9:477-488(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4 AND 5), SEQUENCE REVISION, FUNCTION, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
Tissue: Fetal kidney.
[2]"Cloning and characterization of a novel rho-type GTPase-activating protein gene (ARHGAP6) from the critical region for microphthalmia with linear skin defects."
Schaefer L., Prakash S.K., Zoghbi H.Y.
Genomics 46:268-277(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT GLU-791.
[4]"Phosphoproteome of resting human platelets."
Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A.
J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-264; SER-673; SER-777 AND SER-939, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Platelet.
[5]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF117067 mRNA. Translation: AAF43261.1.
AF177663 mRNA. Translation: AAD53166.1.
AF177665 mRNA. Translation: AAD55087.1.
AF012272 mRNA. Translation: AAC98539.2.
AF022212 mRNA. Translation: AAC98540.2.
BC150635 mRNA. Translation: AAI50636.1.
CCDSCCDS14140.1. [O43182-1]
CCDS14141.1. [O43182-4]
CCDS14142.1. [O43182-2]
PIRE59434.
RefSeqNP_001274171.1. NM_001287242.1.
NP_006116.2. NM_006125.2. [O43182-2]
NP_038267.1. NM_013423.2. [O43182-4]
NP_038286.2. NM_013427.2. [O43182-1]
UniGeneHs.435291.

3D structure databases

ProteinModelPortalO43182.
SMRO43182. Positions 404-605.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid106888. 1 interaction.
STRING9606.ENSP00000338967.

PTM databases

PhosphoSiteO43182.

Proteomic databases

MaxQBO43182.
PaxDbO43182.
PRIDEO43182.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000303025; ENSP00000302312; ENSG00000047648. [O43182-4]
ENST00000337414; ENSP00000338967; ENSG00000047648. [O43182-1]
ENST00000380718; ENSP00000370094; ENSG00000047648. [O43182-2]
ENST00000380732; ENSP00000370108; ENSG00000047648. [O43182-3]
ENST00000380736; ENSP00000370112; ENSG00000047648. [O43182-4]
ENST00000495242; ENSP00000435767; ENSG00000047648. [O43182-3]
GeneID395.
KEGGhsa:395.
UCSCuc004cum.1. human. [O43182-1]
uc004cur.1. human. [O43182-2]

Organism-specific databases

CTD395.
GeneCardsGC0XM011155.
HGNCHGNC:676. ARHGAP6.
HPAHPA036779.
MIM300118. gene.
neXtProtNX_O43182.
PharmGKBPA24960.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG276736.
HOGENOMHOG000231644.
HOVERGENHBG067762.
InParanoidO43182.
OMALRLFKQC.
OrthoDBEOG7FJH1S.
PhylomeDBO43182.
TreeFamTF316710.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressO43182.
BgeeO43182.
CleanExHS_ARHGAP6.
GenevestigatorO43182.

Family and domain databases

Gene3D1.10.555.10. 2 hits.
InterProIPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamPF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTSM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMSSF48350. SSF48350. 1 hit.
PROSITEPS50238. RHOGAP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi395.
NextBio1649.
PROO43182.
SOURCESearch...

Entry information

Entry nameRHG06_HUMAN
AccessionPrimary (citable) accession number: O43182
Secondary accession number(s): B2RWQ0 expand/collapse secondary AC list , O43437, Q9P1B3, Q9UK81, Q9UK82
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: October 3, 2006
Last modified: July 9, 2014
This is version 135 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM