Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O43150

- ASAP2_HUMAN

UniProt

O43150 - ASAP2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

Gene

ASAP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration.3 Publications

GO - Molecular functioni

  1. ARF GTPase activator activity Source: InterPro
  2. enzyme activator activity Source: ProtInc
  3. zinc ion binding Source: InterPro

GO - Biological processi

  1. positive regulation of catalytic activity Source: GOC
  2. regulation of ARF GTPase activity Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2
Alternative name(s):
Development and differentiation-enhancing factor 2
Paxillin-associated protein with ARF GAP activity 3
Short name:
PAG3
Pyk2 C-terminus-associated protein
Short name:
PAP
Gene namesi
Name:ASAP2
Synonyms:DDEF2, KIAA0400
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:2721. ASAP2.

Subcellular locationi

GO - Cellular componenti

  1. Golgi apparatus Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi436 – 4361C → A: Loss of Arf-GAP activity. 1 Publication

Organism-specific databases

PharmGKBiPA164716118.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10061006Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2PRO_0000074198Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei701 – 7011Phosphoserine4 Publications
Modified residuei822 – 8221Phosphoserine1 Publication
Modified residuei903 – 9031Phosphothreonine1 Publication

Post-translational modificationi

Phosphorylated on tyrosine residues by SRC and PTK2B.6 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO43150.
PaxDbiO43150.
PRIDEiO43150.

PTM databases

PhosphoSiteiO43150.

Expressioni

Tissue specificityi

Detected in heart, brain, placenta, kidney, monocytes and pancreas.1 Publication

Inductioni

Up-regulated during monocytic maturation.

Gene expression databases

BgeeiO43150.
CleanExiHS_ASAP2.
ExpressionAtlasiO43150. baseline and differential.
GenevestigatoriO43150.

Organism-specific databases

HPAiCAB018615.

Interactioni

Subunit structurei

Binds PXN, ARF1, ARF5, ARF6, PTK2B and SRC.

Binary interactionsi

WithEntry#Exp.IntActNotes
apcP700394EBI-310968,EBI-8069633From a different organism.
GRB2P629933EBI-310968,EBI-401755
PLCG1P191743EBI-310968,EBI-79387
UBCP0CG482EBI-310968,EBI-3390054

Protein-protein interaction databases

BioGridi114378. 16 interactions.
IntActiO43150. 13 interactions.
MINTiMINT-243403.
STRINGi9606.ENSP00000281419.

Structurei

3D structure databases

ProteinModelPortaliO43150.
SMRiO43150. Positions 30-406, 419-694, 947-1006.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini305 – 39793PHPROSITE-ProRule annotationAdd
BLAST
Domaini421 – 543123Arf-GAPPROSITE-ProRule annotationAdd
BLAST
Repeati584 – 61633ANK 1Add
BLAST
Repeati620 – 64930ANK 2Add
BLAST
Domaini944 – 100663SH3PROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili256 – 28328Sequence AnalysisAdd
BLAST
Coiled coili729 – 75224Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi771 – 936166Pro-richAdd
BLAST

Domaini

The conserved Arg-464 in the Arf-GAP domain probably becomes part of the active site of bound small GTPases and is necessary for GTP hydrolysis.

Sequence similaritiesi

Contains 2 ANK repeats.PROSITE-ProRule annotation
Contains 1 Arf-GAP domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat, SH3 domain

Phylogenomic databases

eggNOGiCOG5347.
GeneTreeiENSGT00760000118874.
HOGENOMiHOG000230570.
HOVERGENiHBG051327.
InParanoidiO43150.
KOiK12488.
OMAiYQLGSNQ.
OrthoDBiEOG7WQ7RJ.
PhylomeDBiO43150.
TreeFamiTF325156.

Family and domain databases

Gene3Di1.20.1270.60. 1 hit.
1.25.40.20. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR027267. AH/BAR-dom.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001164. ArfGAP.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF01412. ArfGap. 1 hit.
PF00169. PH. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00248. ANK. 3 hits.
SM00105. ArfGap. 1 hit.
SM00233. PH. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 1 hit.
PS50115. ARFGAP. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O43150-1) [UniParc]FASTAAdd to Basket

Also known as: PAPalpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPDQISVSEF VAETHEDYKA PTASSFTTRT AQCRNTVAAI EEALDVDRMV
60 70 80 90 100
LYKMKKSVKA INSSGLAHVE NEEQYTQALE KFGGNCVCRD DPDLGSAFLK
110 120 130 140 150
FSVFTKELTA LFKNLIQNMN NIISFPLDSL LKGDLKGVKG DLKKPFDKAW
160 170 180 190 200
KDYETKITKI EKEKKEHAKL HGMIRTEISG AEIAEEMEKE RRFFQLQMCE
210 220 230 240 250
YLLKVNEIKI KKGVDLLQNL IKYFHAQCNF FQDGLKAVES LKPSIETLST
260 270 280 290 300
DLHTIKQAQD EERRQLIQLR DILKSALQVE QKEDSQIRQS TAYSLHQPQG
310 320 330 340 350
NKEHGTERNG SLYKKSDGIR KVWQKRKCSV KNGFLTISHG TANRPPAKLN
360 370 380 390 400
LLTCQVKTNP EEKKCFDLIS HDRTYHFQAE DEQECQIWMS VLQNSKEEAL
410 420 430 440 450
NNAFKGDDNT GENNIVQELT KEIISEVQRM TGNDVCCDCG APDPTWLSTN
460 470 480 490 500
LGILTCIECS GIHRELGVHY SRMQSLTLDV LGTSELLLAK NIGNAGFNEI
510 520 530 540 550
MECCLPAEDS VKPNPGSDMN ARKDYITAKY IERRYARKKH ADNAAKLHSL
560 570 580 590 600
CEAVKTRDIF GLLQAYADGV DLTEKIPLAN GHEPDETALH LAVRSVDRTS
610 620 630 640 650
LHIVDFLVQN SGNLDKQTGK GSTALHYCCL TDNAECLKLL LRGKASIEIA
660 670 680 690 700
NESGETPLDI AKRLKHEHCE ELLTQALSGR FNSHVHVEYE WRLLHEDLDE
710 720 730 740 750
SDDDMDEKLQ PSPNRREDRP ISFYQLGSNQ LQSNAVSLAR DAANLAKEKQ
760 770 780 790 800
RAFMPSILQN ETYGALLSGS PPPAQPAAPS TTSAPPLPPR NVGKVQTASS
810 820 830 840 850
ANTLWKTNSV SVDGGSRQRS SSDPPAVHPP LPPLRVTSTN PLTPTPPPPV
860 870 880 890 900
AKTPSVMEAL SQPSKPAPPG ISQIRPPPLP PQPPSRLPQK KPAPGADKST
910 920 930 940 950
PLTNKGQPRG PVDLSATEAL GPLSNAMVLQ PPAPMPRKSQ ATKLKPKRVK
960 970 980 990 1000
ALYNCVADNP DELTFSEGDV IIVDGEEDQE WWIGHIDGDP GRKGAFPVSF

VHFIAD
Length:1,006
Mass (Da):111,651
Last modified:March 29, 2004 - v3
Checksum:i6A213517DCD99E1B
GO
Isoform 2 (identifier: O43150-2) [UniParc]FASTAAdd to Basket

Also known as: PAPbeta

The sequence of this isoform differs from the canonical sequence as follows:
     795-840: VQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN → D

Show »
Length:961
Mass (Da):106,982
Checksum:i7C8DF5590A4FB792
GO

Sequence cautioni

The sequence BAA23696.2 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti86 – 861C → R in AAH63308. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti748 – 7481E → D.1 Publication
Corresponds to variant rs2715860 [ dbSNP | Ensembl ].
VAR_020307

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei795 – 84046VQTAS…VTSTN → D in isoform 2. 1 PublicationVSP_009722Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007860 mRNA. Translation: BAA23696.2. Different initiation.
CH471053 Genomic DNA. Translation: EAX01004.1.
CH471053 Genomic DNA. Translation: EAX01006.1.
BC063308 mRNA. Translation: AAH63308.1.
CCDSiCCDS1661.1. [O43150-1]
CCDS46224.1. [O43150-2]
PIRiT00050.
RefSeqiNP_001128663.1. NM_001135191.1. [O43150-2]
NP_003878.1. NM_003887.2. [O43150-1]
UniGeneiHs.555902.

Genome annotation databases

EnsembliENST00000281419; ENSP00000281419; ENSG00000151693. [O43150-1]
ENST00000315273; ENSP00000316404; ENSG00000151693. [O43150-2]
GeneIDi8853.
KEGGihsa:8853.
UCSCiuc002qzh.2. human. [O43150-1]
uc002qzi.2. human. [O43150-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007860 mRNA. Translation: BAA23696.2 . Different initiation.
CH471053 Genomic DNA. Translation: EAX01004.1 .
CH471053 Genomic DNA. Translation: EAX01006.1 .
BC063308 mRNA. Translation: AAH63308.1 .
CCDSi CCDS1661.1. [O43150-1 ]
CCDS46224.1. [O43150-2 ]
PIRi T00050.
RefSeqi NP_001128663.1. NM_001135191.1. [O43150-2 ]
NP_003878.1. NM_003887.2. [O43150-1 ]
UniGenei Hs.555902.

3D structure databases

ProteinModelPortali O43150.
SMRi O43150. Positions 30-406, 419-694, 947-1006.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114378. 16 interactions.
IntActi O43150. 13 interactions.
MINTi MINT-243403.
STRINGi 9606.ENSP00000281419.

PTM databases

PhosphoSitei O43150.

Proteomic databases

MaxQBi O43150.
PaxDbi O43150.
PRIDEi O43150.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000281419 ; ENSP00000281419 ; ENSG00000151693 . [O43150-1 ]
ENST00000315273 ; ENSP00000316404 ; ENSG00000151693 . [O43150-2 ]
GeneIDi 8853.
KEGGi hsa:8853.
UCSCi uc002qzh.2. human. [O43150-1 ]
uc002qzi.2. human. [O43150-2 ]

Organism-specific databases

CTDi 8853.
GeneCardsi GC02P009346.
HGNCi HGNC:2721. ASAP2.
HPAi CAB018615.
MIMi 603817. gene.
neXtProti NX_O43150.
PharmGKBi PA164716118.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5347.
GeneTreei ENSGT00760000118874.
HOGENOMi HOG000230570.
HOVERGENi HBG051327.
InParanoidi O43150.
KOi K12488.
OMAi YQLGSNQ.
OrthoDBi EOG7WQ7RJ.
PhylomeDBi O43150.
TreeFami TF325156.

Miscellaneous databases

ChiTaRSi ASAP2. human.
GeneWikii DDEF2.
GenomeRNAii 8853.
NextBioi 33237.
PROi O43150.
SOURCEi Search...

Gene expression databases

Bgeei O43150.
CleanExi HS_ASAP2.
ExpressionAtlasi O43150. baseline and differential.
Genevestigatori O43150.

Family and domain databases

Gene3Di 1.20.1270.60. 1 hit.
1.25.40.20. 1 hit.
2.30.29.30. 1 hit.
InterProi IPR027267. AH/BAR-dom.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001164. ArfGAP.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF00023. Ank. 1 hit.
PF01412. ArfGap. 1 hit.
PF00169. PH. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view ]
PRINTSi PR00405. REVINTRACTNG.
SMARTi SM00248. ANK. 3 hits.
SM00105. ArfGap. 1 hit.
SM00233. PH. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF48403. SSF48403. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 1 hit.
PS50115. ARFGAP. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro."
    Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 4:307-313(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ASP-748.
    Tissue: Placenta.
  4. "Identification of a new Pyk2 target protein with Arf-GAP activity."
    Andreev J., Simon J.-P., Sabatini D.D., Kam J., Plowman G., Randazzo P.A., Schlessinger J.
    Mol. Cell. Biol. 19:2338-2350(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, PHOSPHORYLATION, INTERACTION WITH ARF1; ARF5; ARF6; PTK2B AND SRC, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING.
  5. "A new paxillin-binding protein, PAG3/Papalpha/KIAA0400, bearing an ADP-ribosylation factor GTPase-activating protein activity, is involved in paxillin recruitment to focal adhesions and cell migration."
    Kondo A., Hashimoto S., Yano H., Nagayama K., Mazaki Y., Sabe H.
    Mol. Biol. Cell 11:1315-1327(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF CYS-436, SUBCELLULAR LOCATION, INTERACTION WITH PXN.
  6. "PAG3/Papalpha/KIAA0400, a GTPase-activating protein for ADP-ribosylation factor (ARF), regulates ARF6 in Fcgamma receptor-mediated phagocytosis of macrophages."
    Uchida H., Kondo A., Yoshimura Y., Mazaki Y., Sabe H.
    J. Exp. Med. 193:955-966(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH ARF6 AND ACTIN FILAMENTS.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-701, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-701, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Platelet.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-822, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-701, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-701 AND THR-903, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiASAP2_HUMAN
AccessioniPrimary (citable) accession number: O43150
Secondary accession number(s): D6W4Y8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 29, 2004
Last modified: October 29, 2014
This is version 139 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3