Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

Gene

ASAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration.3 Publications

GO - Molecular functioni

  • enzyme activator activity Source: ProtInc
  • GTPase activator activity Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000151693-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2
Alternative name(s):
Development and differentiation-enhancing factor 2
Paxillin-associated protein with ARF GAP activity 3
Short name:
PAG3
Pyk2 C-terminus-associated protein
Short name:
PAP
Gene namesi
Name:ASAP2
Synonyms:DDEF2, KIAA0400
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:2721. ASAP2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi436C → A: Loss of Arf-GAP activity. 1 Publication1

Organism-specific databases

DisGeNETi8853.
OpenTargetsiENSG00000151693.
PharmGKBiPA164716118.

Polymorphism and mutation databases

BioMutaiASAP2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000741981 – 1006Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2Add BLAST1006

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei701PhosphoserineCombined sources1
Modified residuei822PhosphoserineCombined sources1
Modified residuei903PhosphothreonineCombined sources1

Post-translational modificationi

Phosphorylated on tyrosine residues by SRC and PTK2B.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO43150.
MaxQBiO43150.
PaxDbiO43150.
PeptideAtlasiO43150.
PRIDEiO43150.

PTM databases

iPTMnetiO43150.
PhosphoSitePlusiO43150.

Expressioni

Tissue specificityi

Detected in heart, brain, placenta, kidney, monocytes and pancreas.1 Publication

Inductioni

Up-regulated during monocytic maturation.

Gene expression databases

BgeeiENSG00000151693.
CleanExiHS_ASAP2.
GenevisibleiO43150. HS.

Organism-specific databases

HPAiCAB018615.

Interactioni

Subunit structurei

Binds PXN, ARF1, ARF5, ARF6, PTK2B and SRC.

Binary interactionsi

WithEntry#Exp.IntActNotes
Q5JPT63EBI-310968,EBI-10244213
apcP700394EBI-310968,EBI-8069633From a different organism.
GRB2P629933EBI-310968,EBI-401755
PLCG1P191743EBI-310968,EBI-79387
UBCP0CG482EBI-310968,EBI-3390054

Protein-protein interaction databases

BioGridi114378. 16 interactors.
IntActiO43150. 16 interactors.
MINTiMINT-243403.
STRINGi9606.ENSP00000281419.

Structurei

3D structure databases

ProteinModelPortaliO43150.
SMRiO43150.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini305 – 397PHPROSITE-ProRule annotationAdd BLAST93
Domaini421 – 543Arf-GAPPROSITE-ProRule annotationAdd BLAST123
Repeati584 – 616ANK 1Add BLAST33
Repeati620 – 649ANK 2Add BLAST30
Domaini944 – 1006SH3PROSITE-ProRule annotationAdd BLAST63

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili256 – 283Sequence analysisAdd BLAST28
Coiled coili729 – 752Sequence analysisAdd BLAST24

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi771 – 936Pro-richAdd BLAST166

Domaini

The conserved Arg-464 in the Arf-GAP domain probably becomes part of the active site of bound small GTPases and is necessary for GTP hydrolysis.

Sequence similaritiesi

Contains 2 ANK repeats.PROSITE-ProRule annotation
Contains 1 Arf-GAP domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0521. Eukaryota.
COG5347. LUCA.
GeneTreeiENSGT00760000118874.
HOGENOMiHOG000230570.
HOVERGENiHBG051327.
InParanoidiO43150.
KOiK12488.
OMAiYQLGSNQ.
OrthoDBiEOG091G022H.
PhylomeDBiO43150.
TreeFamiTF325156.

Family and domain databases

Gene3Di1.20.1270.60. 1 hit.
1.25.40.20. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR027267. AH/BAR-dom.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001164. ArfGAP.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
PF01412. ArfGap. 1 hit.
PF00169. PH. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00248. ANK. 3 hits.
SM00105. ArfGap. 1 hit.
SM00233. PH. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 1 hit.
PS50115. ARFGAP. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43150-1) [UniParc]FASTAAdd to basket
Also known as: PAPalpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPDQISVSEF VAETHEDYKA PTASSFTTRT AQCRNTVAAI EEALDVDRMV
60 70 80 90 100
LYKMKKSVKA INSSGLAHVE NEEQYTQALE KFGGNCVCRD DPDLGSAFLK
110 120 130 140 150
FSVFTKELTA LFKNLIQNMN NIISFPLDSL LKGDLKGVKG DLKKPFDKAW
160 170 180 190 200
KDYETKITKI EKEKKEHAKL HGMIRTEISG AEIAEEMEKE RRFFQLQMCE
210 220 230 240 250
YLLKVNEIKI KKGVDLLQNL IKYFHAQCNF FQDGLKAVES LKPSIETLST
260 270 280 290 300
DLHTIKQAQD EERRQLIQLR DILKSALQVE QKEDSQIRQS TAYSLHQPQG
310 320 330 340 350
NKEHGTERNG SLYKKSDGIR KVWQKRKCSV KNGFLTISHG TANRPPAKLN
360 370 380 390 400
LLTCQVKTNP EEKKCFDLIS HDRTYHFQAE DEQECQIWMS VLQNSKEEAL
410 420 430 440 450
NNAFKGDDNT GENNIVQELT KEIISEVQRM TGNDVCCDCG APDPTWLSTN
460 470 480 490 500
LGILTCIECS GIHRELGVHY SRMQSLTLDV LGTSELLLAK NIGNAGFNEI
510 520 530 540 550
MECCLPAEDS VKPNPGSDMN ARKDYITAKY IERRYARKKH ADNAAKLHSL
560 570 580 590 600
CEAVKTRDIF GLLQAYADGV DLTEKIPLAN GHEPDETALH LAVRSVDRTS
610 620 630 640 650
LHIVDFLVQN SGNLDKQTGK GSTALHYCCL TDNAECLKLL LRGKASIEIA
660 670 680 690 700
NESGETPLDI AKRLKHEHCE ELLTQALSGR FNSHVHVEYE WRLLHEDLDE
710 720 730 740 750
SDDDMDEKLQ PSPNRREDRP ISFYQLGSNQ LQSNAVSLAR DAANLAKEKQ
760 770 780 790 800
RAFMPSILQN ETYGALLSGS PPPAQPAAPS TTSAPPLPPR NVGKVQTASS
810 820 830 840 850
ANTLWKTNSV SVDGGSRQRS SSDPPAVHPP LPPLRVTSTN PLTPTPPPPV
860 870 880 890 900
AKTPSVMEAL SQPSKPAPPG ISQIRPPPLP PQPPSRLPQK KPAPGADKST
910 920 930 940 950
PLTNKGQPRG PVDLSATEAL GPLSNAMVLQ PPAPMPRKSQ ATKLKPKRVK
960 970 980 990 1000
ALYNCVADNP DELTFSEGDV IIVDGEEDQE WWIGHIDGDP GRKGAFPVSF

VHFIAD
Length:1,006
Mass (Da):111,651
Last modified:March 29, 2004 - v3
Checksum:i6A213517DCD99E1B
GO
Isoform 2 (identifier: O43150-2) [UniParc]FASTAAdd to basket
Also known as: PAPbeta

The sequence of this isoform differs from the canonical sequence as follows:
     795-840: VQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN → D

Show »
Length:961
Mass (Da):106,982
Checksum:i7C8DF5590A4FB792
GO

Sequence cautioni

The sequence BAA23696 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti86C → R in AAH63308 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_020307748E → D.1 PublicationCorresponds to variant rs2715860dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009722795 – 840VQTAS…VTSTN → D in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007860 mRNA. Translation: BAA23696.2. Different initiation.
CH471053 Genomic DNA. Translation: EAX01004.1.
CH471053 Genomic DNA. Translation: EAX01006.1.
BC063308 mRNA. Translation: AAH63308.1.
CCDSiCCDS1661.1. [O43150-1]
CCDS46224.1. [O43150-2]
PIRiT00050.
RefSeqiNP_001128663.1. NM_001135191.1. [O43150-2]
NP_003878.1. NM_003887.2. [O43150-1]
UniGeneiHs.555902.

Genome annotation databases

EnsembliENST00000281419; ENSP00000281419; ENSG00000151693. [O43150-1]
ENST00000315273; ENSP00000316404; ENSG00000151693. [O43150-2]
GeneIDi8853.
KEGGihsa:8853.
UCSCiuc002qzh.3. human. [O43150-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007860 mRNA. Translation: BAA23696.2. Different initiation.
CH471053 Genomic DNA. Translation: EAX01004.1.
CH471053 Genomic DNA. Translation: EAX01006.1.
BC063308 mRNA. Translation: AAH63308.1.
CCDSiCCDS1661.1. [O43150-1]
CCDS46224.1. [O43150-2]
PIRiT00050.
RefSeqiNP_001128663.1. NM_001135191.1. [O43150-2]
NP_003878.1. NM_003887.2. [O43150-1]
UniGeneiHs.555902.

3D structure databases

ProteinModelPortaliO43150.
SMRiO43150.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114378. 16 interactors.
IntActiO43150. 16 interactors.
MINTiMINT-243403.
STRINGi9606.ENSP00000281419.

PTM databases

iPTMnetiO43150.
PhosphoSitePlusiO43150.

Polymorphism and mutation databases

BioMutaiASAP2.

Proteomic databases

EPDiO43150.
MaxQBiO43150.
PaxDbiO43150.
PeptideAtlasiO43150.
PRIDEiO43150.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000281419; ENSP00000281419; ENSG00000151693. [O43150-1]
ENST00000315273; ENSP00000316404; ENSG00000151693. [O43150-2]
GeneIDi8853.
KEGGihsa:8853.
UCSCiuc002qzh.3. human. [O43150-1]

Organism-specific databases

CTDi8853.
DisGeNETi8853.
GeneCardsiASAP2.
HGNCiHGNC:2721. ASAP2.
HPAiCAB018615.
MIMi603817. gene.
neXtProtiNX_O43150.
OpenTargetsiENSG00000151693.
PharmGKBiPA164716118.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0521. Eukaryota.
COG5347. LUCA.
GeneTreeiENSGT00760000118874.
HOGENOMiHOG000230570.
HOVERGENiHBG051327.
InParanoidiO43150.
KOiK12488.
OMAiYQLGSNQ.
OrthoDBiEOG091G022H.
PhylomeDBiO43150.
TreeFamiTF325156.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000151693-MONOMER.

Miscellaneous databases

ChiTaRSiASAP2. human.
GeneWikiiDDEF2.
GenomeRNAii8853.
PROiO43150.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000151693.
CleanExiHS_ASAP2.
GenevisibleiO43150. HS.

Family and domain databases

Gene3Di1.20.1270.60. 1 hit.
1.25.40.20. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR027267. AH/BAR-dom.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001164. ArfGAP.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
PF01412. ArfGap. 1 hit.
PF00169. PH. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00248. ANK. 3 hits.
SM00105. ArfGap. 1 hit.
SM00233. PH. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 1 hit.
PS50115. ARFGAP. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiASAP2_HUMAN
AccessioniPrimary (citable) accession number: O43150
Secondary accession number(s): D6W4Y8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 29, 2004
Last modified: November 30, 2016
This is version 160 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.