Reviewed,
UniProtKB/Swiss-Prot O43150 (ASAP2_HUMAN)
Last modified
January 19, 2010.
Version 94.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 Alternative name(s): Development and differentiation-enhancing factor 2 Pyk2 C-terminus-associated protein Short name=PAP Paxillin-associated protein with ARF GAP activity 3 Short name=PAG3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1006 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. Ref.3 Ref.4 Ref.5 |
| Subunit structure | Binds PXN, ARF1, ARF5, ARF6, PTK2B and SRC. |
| Subcellular location | Cytoplasm. Golgi apparatus › Golgi stack membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Note: Colocalizes with F-actin and ARF6 in phagocytic cups. Ref.3 Ref.4 Ref.5 |
| Tissue specificity | Detected in heart, brain, placenta, kidney, monocytes and pancreas. Ref.3 |
| Induction | Up-regulated during monocyte maturation. |
| Domain | The conserved Arg-464 in the Arf-GAP domain probably becomes part of the active site of bound small GTPases and is necessary for GTP hydrolysis. |
| Post-translational modification | Phosphorylated on tyrosine residues by SRC and PTK2B. Ref.3 Ref.6 Ref.7 Ref.8 |
| Sequence similarities | Contains 2 ANK repeats. Contains 1 Arf-GAP domain. Contains 1 PH domain. Contains 1 SH3 domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Cytoplasm Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | ANK repeat Coiled coil Repeat SH3 domain |
| Ligand | Metal-binding Zinc |
| Molecular function | GTPase activation |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | regulation of ARF GTPase activity Inferred from electronic annotation. Source: InterPro |
| Cellular component | Golgi apparatus Inferred from electronic annotation. Source: UniProtKB-KW extrinsic to membraneInferred from electronic annotation. Source: UniProtKB-SubCell plasma membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | ARF GTPase activator activity Inferred from electronic annotation. Source: InterPro protein bindingInferred from physical interaction. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CRK | P46108 | 1 | EBI-310968,EBI-886 | |
| FYN | P06241 | 1 | EBI-310968,EBI-515315 | |
| GRB2 | P62993 | 1 | EBI-310968,EBI-401755 | |
| NCK1 | P16333 | 1 | EBI-310968,EBI-389883 | |
| PIK3R1 | P27986 | 1 | EBI-310968,EBI-79464 | |
| PLCG1 | P19174 | 2 | EBI-310968,EBI-79387 | |
| SRC | P12931 | 1 | EBI-310968,EBI-621482 | |
| TBRG4 | Q969Z0 | 1 | EBI-310968,EBI-702328 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43150-1) Also known as: PAPalpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43150-2) Also known as: PAPbeta; The sequence of this isoform differs from the canonical sequence as follows: 795-840: VQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN → D |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1006 | 1006 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 | PRO_0000074198 | |||||
Regions | |||||||||
| Domain | 305 – 397 | 93 | PH | ||||||
| Domain | 421 – 543 | 123 | Arf-GAP | ||||||
| Repeat | 584 – 616 | 33 | ANK 1 | ||||||
| Repeat | 620 – 649 | 30 | ANK 2 | ||||||
| Domain | 944 – 1006 | 63 | SH3 | ||||||
| Coiled coil | 256 – 283 | 28 | Potential | ||||||
| Coiled coil | 729 – 752 | 24 | Potential | ||||||
| Compositional bias | 771 – 936 | 166 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 701 | 1 | Phosphoserine Ref.6 Ref.7 Ref.8 | ||||||
| Modified residue | 822 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 795 – 840 | 46 | VQTAS…VTSTN → D in isoform 2. | VSP_009722 | |||||
| Natural variant | 748 | 1 | E → D: dbSNP rs2715860. Ref.2 | VAR_020307 | |||||
Experimental info | |||||||||
| Mutagenesis | 436 | 1 | C → A: Loss of Arf-GAP activity. Ref.4 | ||||||
| Sequence conflict | 86 | 1 | C → R in AAH63308. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro." Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 4:307-313(1997) [PubMed: 9455477] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ASP-748. Tissue: Placenta. |
| [3] | "Identification of a new Pyk2 target protein with Arf-GAP activity." Andreev J., Simon J.-P., Sabatini D.D., Kam J., Plowman G., Randazzo P.A., Schlessinger J. Mol. Cell. Biol. 19:2338-2350(1999) [PubMed: 10022920] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION, INTERACTION WITH ARF1; ARF5; ARF6; PTK2B AND SRC, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING. |
| [4] | "A new paxillin-binding protein, PAG3/Papalpha/KIAA0400, bearing an ADP-ribosylation factor GTPase-activating protein activity, is involved in paxillin recruitment to focal adhesions and cell migration." Kondo A., Hashimoto S., Yano H., Nagayama K., Mazaki Y., Sabe H. Mol. Biol. Cell 11:1315-1327(2000) [PubMed: 10749932] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF CYS-436, SUBCELLULAR LOCATION, INTERACTION WITH PXN. |
| [5] | "PAG3/Papalpha/KIAA0400, a GTPase-activating protein for ADP-ribosylation factor (ARF), regulates ARF6 in Fcgamma receptor-mediated phagocytosis of macrophages." Uchida H., Kondo A., Yoshimura Y., Mazaki Y., Sabe H. J. Exp. Med. 193:955-966(2001) [PubMed: 11304556] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH ARF6 AND ACTIN FILAMENTS. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-701, MASS SPECTROMETRY. Tissue: Epithelium. |
| [7] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-701, MASS SPECTROMETRY. Tissue: Platelet. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-701 AND SER-822, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB007860 mRNA. Translation: BAA23696.2. Different initiation. BC063308 mRNA. Translation: AAH63308.1. |
| IPI | IPI00022058. IPI00409613. |
| PIR | T00050. |
| RefSeq | NP_001128663.1. NP_003878.1. |
| UniGene | Hs.555902 |
3D structure databases | |
| SMR | O43150. Positions 32-395, 307-406, 419-694, 945-1006. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O43150. 9 interactions. |
| STRING | O43150. |
PTM databases | |
| PhosphoSite | O43150. |
Proteomic databases | |
| PRIDE | O43150. |
Genome annotation databases | |
| Ensembl | ENST00000281419; ENSP00000281419; ENSG00000151693; Homo sapiens. [Genome view] |
| GeneID | 8853. |
| KEGG | hsa:8853. |
| UCSC | uc002qzh.1. human. uc002qzi.1. human. |
Organism-specific databases | |
| CTD | 8853. |
| GeneCards | GC02P009264. |
| H-InvDB | HIX0001806. |
| HGNC | HGNC:2721. ASAP2. |
| HPA | CAB018615. |
| MIM | 603817. gene. |
| PharmGKB | PA27190. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | HBG444660. |
| HOVERGEN | O43150. |
| InParanoid | O43150. |
| OMA | RNGSLYK. |
| OrthoDB | EOG9JWXZP. |
| PhylomeDB | O43150. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | arf6_traffickingpathway. Arf6 trafficking events. |
Gene expression databases | |
| ArrayExpress | O43150. |
| Bgee | O43150. |
| CleanEx | HS_ASAP2. |
| Genevestigator | O43150. |
| GermOnline | ENSG00000151693. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR001164. ArfGAP. IPR011993. PH_type. IPR001849. Pleckstrin_homology. IPR001452. SH3_domain. [Graphical view] |
| Gene3D | G3DSA:1.25.40.20. ANK. 1 hit. G3DSA:2.30.29.30. PH_type. 1 hit. |
| Pfam | PF00023. Ank. 1 hit. PF01412. ArfGap. 1 hit. PF00169. PH. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] |
| PRINTS | PR00405. REVINTRACTNG. |
| SMART | SM00248. ANK. 3 hits. SM00105. ArfGap. 1 hit. SM00233. PH. 1 hit. SM00326. SH3. 1 hit. [Graphical view] |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 1 hit. PS50115. ARFGAP. 1 hit. PS50003. PH_DOMAIN. 1 hit. PS50002. SH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 33237. |
| SOURCE | Search... |
Entry information
| Entry name | ASAP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43150 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


