Reviewed,
UniProtKB/Swiss-Prot O43148 (MCES_HUMAN)
Last modified
June 16, 2009.
Version 61.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: mRNA cap guanine-N7 methyltransferase EC=2.1.1.56 Alternative name(s): mRNA (guanine-N(7)-)-methyltransferase RG7MT1 mRNA cap methyltransferase Short name=hcm1p Short name=hCMT1 Short name=hMet | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 476 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. Binds RNA containing 5'-terminal GpppC. Ref.1 Ref.2 Ref.6 |
| Catalytic activity | S-adenosyl-L-methionine + G(5')pppR-RNA = S-adenosyl-L-homocysteine + m7G(5')pppR-RNA. |
| Subunit structure | Interacts with importin alpha, leading to stimulate both RNA-binding and methyltransferase activity. Interaction with importin alpha and beta is required for its nuclear localization, importin beta dissociating in response to RanGTP, allowing RNMT-importin alpha to bind RNA substrates. Interacts with elongating form of polymerase II and RNGTT. Ref.2 Ref.7 |
| Subcellular location | |
| Tissue specificity | |
| Sequence similarities | Belongs to the mRNA cap methyltransferase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | mRNA capping mRNA processing |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | RNA-binding S-adenosyl-L-methionine |
| Molecular function | Methyltransferase Transferase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | mRNA capping Ref.1 Ref.2 Inferred from mutant phenotype. Source: UniProtKB |
| Cellular component | nucleoplasm Ref.1 Inferred from Experiment. Source: Reactome |
| Molecular function | RNA binding Ref.1 Ref.2 Inferred from mutant phenotype. Source: UniProtKB mRNA (guanine-N7-)-methyltransferase activity Ref.1 Ref.2Inferred from mutant phenotype. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43148-1) Also known as: hCMT1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43148-2) Also known as: hCMT1b; The sequence of this isoform differs from the canonical sequence as follows: 465-476: SIYLVFAFEKQQ → RLTVTIMREAWLSTVGPGRAPVAASSVKWGTPRPAMQFIL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 476 | 476 | mRNA cap guanine-N7 methyltransferase | PRO_0000248321 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 176 – 177 | 2 | mRNA cap binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 126 – 128 | 3 | Nuclear localization signal | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 180 | 1 | S-adenosyl-L-methionine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 205 | 1 | S-adenosyl-L-methionine; via carbonyl oxygen By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 208 | 1 | mRNA cap By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 214 | 1 | mRNA cap By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 227 | 1 | S-adenosyl-L-methionine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 239 | 1 | mRNA cap Probable | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 261 | 1 | S-adenosyl-L-methionine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 284 | 1 | S-adenosyl-L-methionine; via carbonyl oxygen By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 288 | 1 | mRNA cap By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 370 | 1 | mRNA cap By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 467 | 1 | mRNA cap By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 24 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 28 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 465 – 476 | 12 | SIYLV…FEKQQ → RLTVTIMREAWLSTVGPGRA PVAASSVKWGTPRPAMQFIL in isoform 2. | VSP_020241 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 80 – 83 | 4 | KKRK → AAAA: Does not abolish nuclear localization. Abolishes nuclear localization; when associated with 103-AAAAA-107 and I-127. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 103 – 107 | 5 | KKRKR → AAAAA: Does not abolish nuclear localization. Abolishes nuclear localization; when associated with 80-AAAA-83 and I-127. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 127 | 1 | R → I: Does not abolish nuclear localization. Abolishes nuclear localization; when associated with 80-AAAA-83 and 103-AAAAA-107. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 203 | 1 | D → A: Loss of activity. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 239 | 1 | R → A: Loss of activity. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 289 | 1 | Y → A: Loss of activity. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 291 | 1 | F → A: Strongly impairs enzyme activity. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 354 | 1 | F → A: Loss of activity. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 179 | 1 | M → I in BAA82447. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 170 – 193 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 200 – 204 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 207 – 211 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 212 – 217 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 221 – 228 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 230 – 244 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 245 – 247 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 254 – 259 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 262 – 264 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 268 – 270 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 278 – 285 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 287 – 292 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 294 – 305 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 308 – 319 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 321 – 328 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 331 – 337 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 339 – 346 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 357 – 362 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 369 – 371 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 375 – 381 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 382 – 385 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 387 – 394 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 395 – 402 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 406 – 415 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 453 – 456 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 458 – 464 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 467 – 474 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)methyltransferase, an mRNA cap methylase." Tsukamoto T., Shibagaki Y., Niikura Y., Kiyohisa M. Biochem. Biophys. Res. Commun. 251:27-34(1998) [PubMed: 9790902] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Recombinant human mRNA cap methyltransferase binds capping enzyme/RNA polymerase IIo complexes." Pillutla R.C., Yue Z., Maldonado E., Shatkin A.J. J. Biol. Chem. 273:21443-21446(1998) [PubMed: 9705270] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH POLYMERASE II AND RNGTT. |
| [3] | "The Candida albicans gene for mRNA 5'-cap methyltransferase: identification of the additional residues essential for catalysis." Yamada-Okabe T., Mio T., Kashima Y., Matsui M., Arisawa M., Yamada-Okabe H. Microbiology 145:3023-3033(1999) [PubMed: 10589710] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro." Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 4:307-313(1997) [PubMed: 9455477] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Ovary. |
| [6] | "Characterization of human, Schizosaccharomyces pombe, and Candida albicans mRNA cap methyltransferases and complete replacement of the yeast capping apparatus by mammalian enzymes." Saha N., Schwer B., Shuman S. J. Biol. Chem. 274:16553-16562(1999) [PubMed: 10347220] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF ASP-203; ARG-239; TYR-289; PHE-291 AND PHE-354. |
| [7] | "Cap methyltransferase selective binding and methylation of GpppG-RNA are stimulated by importin-alpha." Wen Y., Shatkin A.J. Genes Dev. 14:2944-2949(2000) [PubMed: 11114884] [Abstract] Cited for: SUBCELLULAR LOCATION, RNA-BINDING, INTERACTION WITH IMPORTIN ALPHA. |
| [8] | "Human mRNA cap methyltransferase: alternative nuclear localization signal motifs ensure nuclear localization required for viability." Shafer B., Chu C., Shatkin A.J. Mol. Cell. Biol. 25:2644-2649(2005) [PubMed: 15767670] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF 80-LYS--LYS-83; 103-LYS--ARG-107 AND ARG-127. |
| [9] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AB022604 mRNA. Translation: BAA74464.1. AB022605 mRNA. Translation: BAA74463.1. AF067791 mRNA. Translation: AAC63269.1. AB020966 mRNA. Translation: BAA82447.1. AB007858 mRNA. Translation: BAA23694.1. BC036798 mRNA. Translation: AAH36798.1. | |||||||||||||||||||
| IPI | IPI00410657. IPI00747403. | ||||||||||||||||||
| RefSeq | NP_003790.1. | ||||||||||||||||||
| UniGene | Hs.592347 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O43148. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | O43148. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSG00000101654. Homo sapiens. [Contig view] | ||||||||||||||||||
| GeneID | 8731. | ||||||||||||||||||
| KEGG | hsa:8731. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| GeneCards | GC18P013716. | ||||||||||||||||||
| HGNC | HGNC:10075. RNMT. | ||||||||||||||||||
| MIM | 603514. gene. | ||||||||||||||||||
| PharmGKB | PA34448. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOVERGEN | O43148. | ||||||||||||||||||
| OMA | O43148. KYMKNSQ. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 2.1.1.56. 247. | ||||||||||||||||||
| Reactome | REACT_1675. mRNA Processing. REACT_1788. Transcription. REACT_6185. HIV Infection. REACT_71. Gene Expression. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O43148. | ||||||||||||||||||
| Bgee | O43148. | ||||||||||||||||||
| CleanEx | HS_RNMT. | ||||||||||||||||||
| GermOnline | ENSG00000101654. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR016899. mRNA_G-N7_MeTrfase. IPR004971. Pox_MCEL. [Graphical view] | ||||||||||||||||||
| Pfam | PF03291. Pox_MCEL. 1 hit. [Graphical view] | ||||||||||||||||||
| PIRSF | PIRSF028762. ABD1. 1 hit. | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 32753. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | MCES_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O43148 Secondary accession number(s): O94996, Q9UIJ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


