Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O35795 (ENTP2_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 102. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ectonucleoside triphosphate diphosphohydrolase 2

Short name=NTPDase 2
EC=3.6.1.-
Alternative name(s):
CD39 antigen-like 1
Ecto-ATP diphosphohydrolase 2
Short name=Ecto-ATPDase 2
Short name=Ecto-ATPase 2
Gene names
Name:Entpd2
Synonyms:Cd39l1
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length495 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Hydrolyzes ADP only to a marginal extent.

Cofactor

Ca2+ or Mg2+.

Subcellular location

Isoform 1: Cell membrane; Multi-pass membrane protein By similarity.

Tissue specificity

Expressed in brain, heart, vas deferens, kidney, skeletal muscle, thymus, lung and spleen. Weak expression in liver.

Induction

By FSH in Sertoli cells but not in peritubular cells; by cAMP in both type of cells.

Sequence similarities

Belongs to the GDA1/CD39 NTPase family.

Ontologies

Keywords
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   LigandATP-binding
Calcium
Magnesium
Nucleotide-binding
   Molecular functionHydrolase
   PTMDisulfide bond
Glycoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

hydrolase activity

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O35795-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O35795-2)

The sequence of this isoform differs from the canonical sequence as follows:
     486-495: VRSAKSPGAL → DVRSQPVTQGEVHSEWDFCSDLQGPGNFLSGPLERQAPEPTGWESVPCLLVKTFVIKDFS

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 495495Ectonucleoside triphosphate diphosphohydrolase 2
PRO_0000209908

Regions

Topological domain1 – 44Cytoplasmic Potential
Transmembrane5 – 2521Helical; Potential
Topological domain26 – 462437Extracellular Potential
Transmembrane463 – 48321Helical; Potential
Topological domain484 – 49512Cytoplasmic Potential
Nucleotide binding204 – 2085ATP

Sites

Active site1651Proton acceptor Ref.4

Amino acid modifications

Glycosylation641N-linked (GlcNAc...) Potential
Glycosylation1291N-linked (GlcNAc...) Potential
Glycosylation2941N-linked (GlcNAc...) Potential
Glycosylation3061N-linked (GlcNAc...) Potential
Glycosylation3191N-linked (GlcNAc...) Potential
Glycosylation3781N-linked (GlcNAc...) Potential
Glycosylation4431N-linked (GlcNAc...) Potential
Disulfide bond75 ↔ 99 Ref.4
Disulfide bond242 ↔ 284 Ref.4
Disulfide bond265 ↔ 310 Ref.4
Disulfide bond323 ↔ 328 Ref.4
Disulfide bond377 ↔ 399 Ref.4

Natural variations

Alternative sequence486 – 49510VRSAKSPGAL → DVRSQPVTQGEVHSEWDFCS DLQGPGNFLSGPLERQAPEP TGWESVPCLLVKTFVIKDFS in isoform 2.
VSP_003613

Experimental info

Sequence conflict201T → A in AAF87740. Ref.2
Sequence conflict127 – 1282PF → LL in AAF87740. Ref.2
Sequence conflict3391A → T in AAF87740. Ref.2
Sequence conflict4441L → F in AAF87740. Ref.2

Secondary structure

.......................................................................... 495
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 1, 1998. Version 1.
Checksum: 237B999F1BEB8E00

FASTA49554,390
        10         20         30         40         50         60 
MAGKLVSLVP PLLLAAAGLT GLLLLCVPTQ DVREPPALKY GIVLDAGSSH TSMFVYKWPA 

        70         80         90        100        110        120 
DKENDTGIVG QHSSCDVQGG GISSYANDPS KAGQSLVRCL EQALRDVPRD RHASTPLYLG 

       130        140        150        160        170        180 
ATAGMRPFNL TSPEATARVL EAVTQTLTQY PFDFRGARIL SGQDEGVFGW VTANYLLENF 

       190        200        210        220        230        240 
IKYGWVGRWI RPRKGTLGAM DLGGASTQIT FETTSPSEDP GNEVHLRLYG QHYRVYTHSF 

       250        260        270        280        290        300 
LCYGRDQILL RLLASALQIH RFHPCWPKGY STQVLLQEVY QSPCTMGQRP RAFNGSAIVS 

       310        320        330        340        350        360 
LSGTSNATLC RDLVSRLFNI SSCPFSQCSF NGVFQPPVAG NFIAFSAFYY TVDFLTTVMG 

       370        380        390        400        410        420 
LPVGTLKQLE EATEITCNQT WTELQARVPG QKTRLADYCA VAMFIHQLLS RGYHFDERSF 

       430        440        450        460        470        480 
REVVFQKKAA DTAVGWALGY MLNLTNLIPA DLPGLRKGTH FSSWVALLLL FTVLILAALV 

       490 
LLLRQVRSAK SPGAL 

« Hide

Isoform 2 [UniParc].

Checksum: 9802C097CA40E93C
Show »

FASTA54560,067

References

[1]"An ecto-ATPase and an ecto-ATP diphosphohydrolase are expressed in rat brain."
Kegel B., Braun N., Heine P., Maliszewski C.R., Zimmermann H.
Neuropharmacology 36:1189-1200(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
Strain: Sprague-Dawley.
Tissue: Brain.
[2]"Ecto-ATPase mRNA is regulated by FSH in Sertoli cells."
Lu Q., Porter L.D., Cui X., Sanborn B.M.
J. Androl. 22:289-301(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: Sprague-Dawley.
Tissue: Sertoli cell.
[3]"Evidence for alternative splicing of ecto-ATPase associated with termination of purinergic transmission."
Vlajkovic S.M., Housley G.D., Greenwood D., Thorne P.R.
Brain Res. Mol. Brain Res. 73:85-92(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 379-495 (ISOFORM 2).
Strain: Wistar.
Tissue: Cochlea.
[4]"Structural insight into signal conversion and inactivation by NTPDase2 in purinergic signaling."
Zebisch M., Strater N.
Proc. Natl. Acad. Sci. U.S.A. 105:6882-6887(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 28-461 ALONE AND IN COMPLEX WITH ATP ANALOGS AND CALCIUM, ACTIVE SITE, DISULFIDE BONDS.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Y11835 mRNA. Translation: CAA72533.1.
AF276940 mRNA. Translation: AAF87740.1.
AF129103 mRNA. Translation: AAD42303.1.
RefSeqNP_742027.1. NM_172030.1.
UniGeneRn.8276.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3CJ1X-ray1.70A29-461[»]
3CJ7X-ray1.80A29-461[»]
3CJ9X-ray1.80A29-461[»]
3CJAX-ray2.10A29-461[»]
4BQZX-ray2.05A28-462[»]
4BR0X-ray2.05A28-462[»]
4BR2X-ray2.00A28-462[»]
4CD1X-ray2.00A28-462[»]
4CD3X-ray2.19A28-461[»]
ProteinModelPortalO35795.
SMRO35795. Positions 36-461.
ModBaseSearch...
MobiDBSearch...

Chemistry

BindingDBO35795.
ChEMBLCHEMBL3300.

Proteomic databases

PaxDbO35795.
PRIDEO35795.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID64467.
KEGGrno:64467.
UCSCRGD:69266. rat. [O35795-1]

Organism-specific databases

CTD954.
RGD69266. Entpd2.

Phylogenomic databases

eggNOGCOG5371.
HOGENOMHOG000059572.
HOVERGENHBG018982.
KOK01509.
PhylomeDBO35795.

Gene expression databases

GenevestigatorO35795.

Family and domain databases

InterProIPR000407. GDA1_CD39_NTPase.
[Graphical view]
PANTHERPTHR11782. PTHR11782. 1 hit.
PfamPF01150. GDA1_CD39. 1 hit.
[Graphical view]
PROSITEPS01238. GDA1_CD39_NTPASE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceO35795.
NextBio613232.
PROO35795.

Entry information

Entry nameENTP2_RAT
AccessionPrimary (citable) accession number: O35795
Secondary accession number(s): Q9JHY5, Q9WVE7
Entry history
Integrated into UniProtKB/Swiss-Prot: August 29, 2001
Last sequence update: January 1, 1998
Last modified: May 14, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references