Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O35714

- TNR18_MOUSE

UniProt

O35714 - TNR18_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tumor necrosis factor receptor superfamily member 18

Gene

Tnfrsf18

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway (By similarity).By similarity

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 18
Alternative name(s):
Glucocorticoid-induced TNFR-related protein
CD_antigen: CD357
Gene namesi
Name:Tnfrsf18
Synonyms:Gitr
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 4

Organism-specific databases

MGIiMGI:894675. Tnfrsf18.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 153134ExtracellularSequence AnalysisAdd
BLAST
Transmembranei154 – 17421HelicalSequence AnalysisAdd
BLAST
Topological domaini175 – 22854CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. external side of plasma membrane Source: MGI
  2. extracellular region Source: UniProtKB-KW
  3. integral component of plasma membrane Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi199 – 1991S → A: Does not bind to SIVA1. 1 Publication
Mutagenesisi201 – 2011E → R: No effect on binding to SIVA1; when associated with G-204. 1 Publication
Mutagenesisi204 – 2041C → G: No effect on binding to SIVA1; when associated with R-201. 1 Publication
Mutagenesisi209 – 2091P → A: Does not bind to SIVA1. 1 Publication
Mutagenesisi210 – 2123EEE → RVV: Does not bind to SIVA1. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 228209Tumor necrosis factor receptor superfamily member 18PRO_0000034596Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi29 ↔ 44By similarity
Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis
Glycosylationi40 – 401N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi62 ↔ 74By similarity
Disulfide bondi69 ↔ 82By similarity
Disulfide bondi103 ↔ 122By similarity
Disulfide bondi116 ↔ 141By similarity
Glycosylationi121 – 1211N-linked (GlcNAc...)Sequence Analysis
Glycosylationi134 – 1341N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiO35714.

Expressioni

Tissue specificityi

Preferentially expressed in activated T lymphocytes.

Inductioni

Up-regulated in peripherical mononuclear cells after antigen stimulation/lymphocyte activation.

Gene expression databases

BgeeiO35714.
ExpressionAtlasiO35714. baseline and differential.
GenevestigatoriO35714.

Interactioni

Subunit structurei

Binds to TRAF1, TRAF2, and TRAF3, but not TRAF5 and TRAF6 (By similarity). Binds through its C-terminus to SIVA1/SIVA.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Tnfsf18Q7TS553EBI-523358,EBI-523345

Protein-protein interaction databases

DIPiDIP-29666N.
IntActiO35714. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliO35714.
SMRiO35714. Positions 27-146.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati28 – 6134TNFR-Cys 1Add
BLAST
Repeati62 – 10140TNFR-Cys 2Add
BLAST
Repeati102 – 14241TNFR-Cys 3Add
BLAST

Sequence similaritiesi

Contains 3 TNFR-Cys repeats.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG46178.
GeneTreeiENSGT00730000111424.
HOGENOMiHOG000049155.
HOVERGENiHBG054195.
InParanoidiO35714.
KOiK05154.
OrthoDBiEOG7XH6QM.
TreeFamiTF336151.

Family and domain databases

InterProiIPR000742. EG-like_dom.
IPR001368. TNFR/NGFR_Cys_rich_reg.
IPR022318. TNFR_18.
[Graphical view]
PRINTSiPR01968. TNFACTORR18.
SMARTiSM00181. EGF. 1 hit.
SM00208. TNFR. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform A (identifier: O35714-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAWAMLYGV SMLCVLDLGQ PSVVEEPGCG PGKVQNGSGN NTRCCSLYAP
60 70 80 90 100
GKEDCPKERC ICVTPEYHCG DPQCKICKHY PCQPGQRVES QGDIVFGFRC
110 120 130 140 150
VACAMGTFSA GRDGHCRLWT NCSQFGFLTM FPGNKTHNAV CIPEPLPTEQ
160 170 180 190 200
YGHLTVIFLV MAACIFFLTT VQLGLHIWQL RRQHMCPRET QPFAEVQLSA
210 220
EDACSFQFPE EERGEQTEEK CHLGGRWP
Length:228
Mass (Da):25,334
Last modified:January 1, 1998 - v1
Checksum:i50D8C275D9C56259
GO
Isoform B (identifier: O35714-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-228: ETQPFAEVQL...EKCHLGGRWP → VLLQRPSHSR...RLGPMAAFLI

Show »
Length:294
Mass (Da):32,658
Checksum:iFE0D4AE6A007BA9A
GO
Isoform C (identifier: O35714-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-228: ETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP → GQLCPREGENVSQAPHLPQFYYRDPAIRGGAVVS

Show »
Length:222
Mass (Da):24,450
Checksum:i594932BA425A79CA
GO
Isoform D (identifier: O35714-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-228: NCSQFGFLTM...EKCHLGGRWP → KDPAIRGGAVVS

Show »
Length:132
Mass (Da):14,106
Checksum:iF586A5404B1DFEDE
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei121 – 228108NCSQF…GGRWP → KDPAIRGGAVVS in isoform D. 1 PublicationVSP_006509Add
BLAST
Alternative sequencei189 – 22840ETQPF…GGRWP → VLLQRPSHSRRCSCQLRMLA ASSSLRRNAGSRQKKSVIWG VGGHEAWSSSVPQARRYKTC PAIPLVRAGAMLCTLPWAWP CSPQQWRKWVYESGELRLGP MAAFLI in isoform B. 1 PublicationVSP_006510Add
BLAST
Alternative sequencei189 – 22840ETQPF…GGRWP → GQLCPREGENVSQAPHLPQF YYRDPAIRGGAVVS in isoform C. 1 PublicationVSP_006511Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U82534 mRNA. Translation: AAB81243.1.
AF109216 Genomic DNA. Translation: AAF14231.1.
AF229432 mRNA. Translation: AAF61566.1.
AF229433 mRNA. Translation: AAF61567.1.
AF229434 mRNA. Translation: AAF61568.1.
AK020762 mRNA. Translation: BAC25639.1.
CCDSiCCDS19056.1. [O35714-1]
CCDS19057.1. [O35714-4]
RefSeqiNP_033426.1. NM_009400.2. [O35714-1]
NP_068820.1. NM_021985.2. [O35714-4]
UniGeneiMm.3180.

Genome annotation databases

EnsembliENSMUST00000040274; ENSMUSP00000040035; ENSMUSG00000041954. [O35714-4]
ENSMUST00000103173; ENSMUSP00000099462; ENSMUSG00000041954. [O35714-1]
GeneIDi21936.
KEGGimmu:21936.
UCSCiuc008wfx.1. mouse. [O35714-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U82534 mRNA. Translation: AAB81243.1 .
AF109216 Genomic DNA. Translation: AAF14231.1 .
AF229432 mRNA. Translation: AAF61566.1 .
AF229433 mRNA. Translation: AAF61567.1 .
AF229434 mRNA. Translation: AAF61568.1 .
AK020762 mRNA. Translation: BAC25639.1 .
CCDSi CCDS19056.1. [O35714-1 ]
CCDS19057.1. [O35714-4 ]
RefSeqi NP_033426.1. NM_009400.2. [O35714-1 ]
NP_068820.1. NM_021985.2. [O35714-4 ]
UniGenei Mm.3180.

3D structure databases

ProteinModelPortali O35714.
SMRi O35714. Positions 27-146.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-29666N.
IntActi O35714. 1 interaction.

Proteomic databases

PRIDEi O35714.

Protocols and materials databases

DNASUi 21936.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000040274 ; ENSMUSP00000040035 ; ENSMUSG00000041954 . [O35714-4 ]
ENSMUST00000103173 ; ENSMUSP00000099462 ; ENSMUSG00000041954 . [O35714-1 ]
GeneIDi 21936.
KEGGi mmu:21936.
UCSCi uc008wfx.1. mouse. [O35714-1 ]

Organism-specific databases

CTDi 8784.
MGIi MGI:894675. Tnfrsf18.

Phylogenomic databases

eggNOGi NOG46178.
GeneTreei ENSGT00730000111424.
HOGENOMi HOG000049155.
HOVERGENi HBG054195.
InParanoidi O35714.
KOi K05154.
OrthoDBi EOG7XH6QM.
TreeFami TF336151.

Miscellaneous databases

NextBioi 301540.
PROi O35714.
SOURCEi Search...

Gene expression databases

Bgeei O35714.
ExpressionAtlasi O35714. baseline and differential.
Genevestigatori O35714.

Family and domain databases

InterProi IPR000742. EG-like_dom.
IPR001368. TNFR/NGFR_Cys_rich_reg.
IPR022318. TNFR_18.
[Graphical view ]
PRINTSi PR01968. TNFACTORR18.
SMARTi SM00181. EGF. 1 hit.
SM00208. TNFR. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A new member of the tumor necrosis factor/nerve growth factor receptor family inhibits T cell receptor-induced apoptosis."
    Nocentini G., Giunchi L., Ronchetti S., Krausz L.T., Bartoli A., Moraca R., Migliorati G., Riccardi C.
    Proc. Natl. Acad. Sci. U.S.A. 94:6216-6221(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
    Strain: C3H.
  2. "Gene structure and chromosomal assignment of mouse GITR, a member of the tumor necrosis factor/nerve growth factor receptor family."
    Nocentini G., Bartoli A., Ronchetti S., Giunchi L., Cupelli A., Delfino D., Migliorati G., Riccardi C.
    DNA Cell Biol. 19:205-217(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM A).
    Strain: BALB/c.
  3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; C AND D).
    Tissue: Thymus.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Strain: C57BL/6J.
    Tissue: Thymus.
  5. "GITR interacts with the pro-apoptotic protein Siva and induces apoptosis."
    Spinicelli S., Nocentini G., Ronchetti S., Krausz L.T., Bianchini R., Riccardi C.
    Cell Death Differ. 9:1382-1384(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SIVA1, MUTAGENESIS OF SER-199; GLU-201; CYS-204; PRO-209 AND 210-GLU--GLU-212.

Entry informationi

Entry nameiTNR18_MOUSE
AccessioniPrimary (citable) accession number: O35714
Secondary accession number(s): Q9JKR1, Q9JKR2, Q9JKR3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: January 1, 1998
Last modified: November 26, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3