O35714 (TNR18_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tumor necrosis factor receptor superfamily member 18 Alternative name(s): Glucocorticoid-induced TNFR-related protein CD_antigen=CD357 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 228 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway By similarity. |
| Subunit structure | Binds to TRAF1, TRAF2, and TRAF3, but not TRAF5 and TRAF6 By similarity. Binds through its C-terminus to SIVA1/SIVA. Ref.5 |
| Subcellular location | Isoform A: Cell membrane; Single-pass type I membrane protein. Isoform B: Cell membrane; Single-pass type I membrane protein. Isoform C: Cell membrane; Single-pass type I membrane protein. |
| Tissue specificity | Preferentially expressed in activated T lymphocytes. |
| Induction | Up-regulated in peripherical mononuclear cells after antigen stimulation/lymphocyte activation. |
| Sequence similarities | Contains 3 TNFR-Cys repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | apoptotic process Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | external side of plasma membrane Inferred from direct assay PubMed 16227984PubMed 16769892. Source: MGI extracellular regionInferred from electronic annotation. Source: UniProtKB-SubCell integral to plasma membraneInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Tnfsf18 | Q7TS55 | 3 | EBI-523358,EBI-523345 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: O35714-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: O35714-2) The sequence of this isoform differs from the canonical sequence as follows: 189-228: ETQPFAEVQL...EKCHLGGRWP → VLLQRPSHSR...RLGPMAAFLI | ||||||
| Isoform C (identifier: O35714-3) The sequence of this isoform differs from the canonical sequence as follows: 189-228: ETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP → GQLCPREGENVSQAPHLPQFYYRDPAIRGGAVVS | ||||||
| Isoform D (identifier: O35714-4) The sequence of this isoform differs from the canonical sequence as follows: 121-228: NCSQFGFLTM...EKCHLGGRWP → KDPAIRGGAVVS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Potential | ||||||||
| Chain | 20 – 228 | 209 | Tumor necrosis factor receptor superfamily member 18 | PRO_0000034596 | |||||||
Regions | |||||||||||
| Topological domain | 20 – 153 | 134 | Extracellular Potential | ||||||||
| Transmembrane | 154 – 174 | 21 | Helical; Potential | ||||||||
| Topological domain | 175 – 228 | 54 | Cytoplasmic Potential | ||||||||
| Repeat | 28 – 61 | 34 | TNFR-Cys 1 | ||||||||
| Repeat | 62 – 101 | 40 | TNFR-Cys 2 | ||||||||
| Repeat | 102 – 142 | 41 | TNFR-Cys 3 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 36 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 40 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 121 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 134 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 29 ↔ 44 | By similarity | |||||||||
| Disulfide bond | 62 ↔ 74 | By similarity | |||||||||
| Disulfide bond | 69 ↔ 82 | By similarity | |||||||||
| Disulfide bond | 103 ↔ 122 | By similarity | |||||||||
| Disulfide bond | 116 ↔ 141 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 121 – 228 | 108 | NCSQF…GGRWP → KDPAIRGGAVVS in isoform D. | VSP_006509 | |||||||
| Alternative sequence | 189 – 228 | 40 | ETQPF…GGRWP → VLLQRPSHSRRCSCQLRMLA ASSSLRRNAGSRQKKSVIWG VGGHEAWSSSVPQARRYKTC PAIPLVRAGAMLCTLPWAWP CSPQQWRKWVYESGELRLGP MAAFLI in isoform B. | VSP_006510 | |||||||
| Alternative sequence | 189 – 228 | 40 | ETQPF…GGRWP → GQLCPREGENVSQAPHLPQF YYRDPAIRGGAVVS in isoform C. | VSP_006511 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 199 | 1 | S → A: Does not bind to SIVA1. Ref.5 | ||||||||
| Mutagenesis | 201 | 1 | E → R: No effect on binding to SIVA1; when associated with G-204. Ref.5 | ||||||||
| Mutagenesis | 204 | 1 | C → G: No effect on binding to SIVA1; when associated with R-201. Ref.5 | ||||||||
| Mutagenesis | 209 | 1 | P → A: Does not bind to SIVA1. Ref.5 | ||||||||
| Mutagenesis | 210 – 212 | 3 | EEE → RVV: Does not bind to SIVA1. Ref.5 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A new member of the tumor necrosis factor/nerve growth factor receptor family inhibits T cell receptor-induced apoptosis." Nocentini G., Giunchi L., Ronchetti S., Krausz L.T., Bartoli A., Moraca R., Migliorati G., Riccardi C. Proc. Natl. Acad. Sci. U.S.A. 94:6216-6221(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). Strain: C3H. |
| [2] | "Gene structure and chromosomal assignment of mouse GITR, a member of the tumor necrosis factor/nerve growth factor receptor family." Nocentini G., Bartoli A., Ronchetti S., Giunchi L., Cupelli A., Delfino D., Migliorati G., Riccardi C. DNA Cell Biol. 19:205-217(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM A). Strain: BALB/c. |
| [3] | "Identification of three novel mRNA splice variants of GITR." Nocentini G., Ronchetti S., Bartoli A., Spinicelli S., Delfino D., Brunetti L., Migliorati G., Riccardi C. Cell Death Differ. 7:408-410(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; C AND D). Tissue: Thymus. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Strain: C57BL/6J. Tissue: Thymus. |
| [5] | "GITR interacts with the pro-apoptotic protein Siva and induces apoptosis." Spinicelli S., Nocentini G., Ronchetti S., Krausz L.T., Bianchini R., Riccardi C. Cell Death Differ. 9:1382-1384(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SIVA1, MUTAGENESIS OF SER-199; GLU-201; CYS-204; PRO-209 AND 210-GLU--GLU-212. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U82534 mRNA. Translation: AAB81243.1. AF109216 Genomic DNA. Translation: AAF14231.1. AF229432 mRNA. Translation: AAF61566.1. AF229433 mRNA. Translation: AAF61567.1. AF229434 mRNA. Translation: AAF61568.1. AK020762 mRNA. Translation: BAC25639.1. |
| IPI | IPI00229461. IPI00229462. IPI00229463. IPI00989641. |
| RefSeq | NP_033426.1. NM_009400.2. NP_068820.1. NM_021985.2. |
| UniGene | Mm.3180. |
3D structure databases | |
| ProteinModelPortal | O35714. |
| SMR | O35714. Positions 29-146. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-29666N. |
| IntAct | O35714. 1 interaction. |
Proteomic databases | |
| PRIDE | O35714. |
Protocols and materials databases | |
| DNASU | 21936. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000040274; ENSMUSP00000040035; ENSMUSG00000041954. ENSMUST00000103173; ENSMUSP00000099462; ENSMUSG00000041954. |
| GeneID | 21936. |
| KEGG | mmu:21936. |
Organism-specific databases | |
| CTD | 8784. |
| MGI | MGI:894675. Tnfrsf18. |
Phylogenomic databases | |
| eggNOG | NOG46178. |
| GeneTree | ENSGT00700000104530. |
| HOGENOM | HOG000049155. |
| HOVERGEN | HBG054195. |
| KO | K05154. |
| OrthoDB | EOG437RG7. |
Gene expression databases | |
| ArrayExpress | O35714. |
| Bgee | O35714. |
| Genevestigator | O35714. |
| GermOnline | ENSMUSG00000041954. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000742. EG-like_dom. IPR001368. TNFR/NGFR_Cys_rich_reg. IPR022318. TNFR_18. [Graphical view] |
| PRINTS | PR01968. TNFACTORR18. |
| SMART | SM00181. EGF. 1 hit. SM00208. TNFR. 2 hits. [Graphical view] |
| PROSITE | PS00652. TNFR_NGFR_1. False negative. PS50050. TNFR_NGFR_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | TNFRSF18. mouse. |
| NextBio | 301540. |
| SOURCE | Search... |
Entry information
| Entry name | TNR18_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O35714 Secondary accession number(s): Q9JKR1, Q9JKR2, Q9JKR3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
