SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O35548

- MMP16_RAT

UniProt

O35548 - MMP16_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Matrix metalloproteinase-16
Gene
Mmp16
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Endopeptidase that degrades various components of the extracellular matrix, such as collagen type III and fibronectin. Activates progelatinase A. Involved in the matrix remodeling of blood vessels. The short isoform efficiently converts progelatinase A to the intermediate form but not to the mature one. It has no effect on type I, II, IV and V collagen. However, upon interaction with CSPG4, it may be involved in degradation and invasion of type I collagen by melanoma cells.

Cofactori

Binds 1 zinc ion per subunit By similarity.
Calcium By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi101 – 1011Zinc 1; in inhibited form By similarity
Metal bindingi183 – 1831Calcium 1; via carbonyl oxygen By similarity
Metal bindingi193 – 1931Zinc 1 By similarity
Metal bindingi195 – 1951Zinc 1 By similarity
Metal bindingi200 – 2001Calcium 2 By similarity
Metal bindingi201 – 2011Calcium 2; via carbonyl oxygen By similarity
Metal bindingi203 – 2031Calcium 2; via carbonyl oxygen By similarity
Metal bindingi205 – 2051Calcium 2; via carbonyl oxygen By similarity
Metal bindingi215 – 2151Calcium 1; via carbonyl oxygen By similarity
Metal bindingi217 – 2171Calcium 1; via carbonyl oxygen By similarity
Metal bindingi219 – 2191Calcium 1 By similarity
Metal bindingi223 – 2231Calcium 2 By similarity
Metal bindingi226 – 2261Calcium 2 By similarity
Metal bindingi246 – 2461Zinc 2; catalytic By similarity
Active sitei247 – 2471 By similarity
Metal bindingi250 – 2501Zinc 2; catalytic By similarity
Metal bindingi256 – 2561Zinc 2; catalytic By similarity

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. metalloendopeptidase activity Source: InterPro
  3. zinc ion binding Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. collagen catabolic process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Biological processi

Collagen degradation

Keywords - Ligandi

Calcium, Metal-binding, Zinc

Protein family/group databases

MEROPSiM10.016.

Names & Taxonomyi

Protein namesi
Recommended name:
Matrix metalloproteinase-16 (EC:3.4.24.-)
Short name:
MMP-16
Alternative name(s):
Membrane-type matrix metalloproteinase 3
Short name:
MT-MMP 3
Short name:
MTMMP3
Membrane-type-3 matrix metalloproteinase
Short name:
MT3-MMP
Short name:
MT3MMP
Gene namesi
Name:Mmp16
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi620199. Mmp16.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein; Extracellular side Reviewed prediction
Note: Localized at the cell surface of melanoma cells By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini120 – 564445Extracellular Reviewed prediction
Add
BLAST
Transmembranei565 – 58521Helical; Reviewed prediction
Add
BLAST
Topological domaini586 – 60722Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
  3. proteinaceous extracellular matrix Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Extracellular matrix, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131 Reviewed prediction
Add
BLAST
Propeptidei32 – 11988 By similarity
PRO_0000028816Add
BLAST
Chaini120 – 607488Matrix metalloproteinase-16
PRO_0000028817Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi83 – 831N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi343 ↔ 532 By similarity

Post-translational modificationi

The precursor is cleaved by a furin endopeptidase By similarity.

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

PaxDbiO35548.
PRIDEiO35548.

PTM databases

PhosphoSiteiO35548.

Expressioni

Tissue specificityi

Strongly expressed in the lung, brain and smooth muscle cells. Weakly detectable in the spleen and liver and indetectable in the heart, skeletal muscle and kidney.

Gene expression databases

GenevestigatoriO35548.

Interactioni

Subunit structurei

Interacts with CSPG4 through CSPG4 chondroitin sulfate glycosaminoglycan By similarity.

Structurei

3D structure databases

ProteinModelPortaliO35548.
SMRiO35548. Positions 124-292.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati340 – 38849Hemopexin 1
Add
BLAST
Repeati389 – 43446Hemopexin 2
Add
BLAST
Repeati436 – 48449Hemopexin 3
Add
BLAST
Repeati485 – 53248Hemopexin 4
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi99 – 1068Cysteine switch By similarity

Domaini

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Sequence similaritiesi

Belongs to the peptidase M10A family.
Contains 4 hemopexin repeats.

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG295915.
HOGENOMiHOG000217928.
HOVERGENiHBG052484.
KOiK07996.
PhylomeDBiO35548.

Family and domain databases

Gene3Di2.110.10.10. 1 hit.
3.40.390.10. 1 hit.
InterProiIPR000585. Hemopexin-like_dom.
IPR018487. Hemopexin-like_repeat.
IPR018486. Hemopexin_CS.
IPR024079. MetalloPept_cat_dom.
IPR028697. MMP16.
IPR001818. Pept_M10_metallopeptidase.
IPR021190. Pept_M10A.
IPR021805. Pept_M10A_metallopeptidase_C.
IPR016293. Pept_M10A_stromelysin-type.
IPR021158. Pept_M10A_Zn_BS.
IPR006026. Peptidase_Metallo.
IPR002477. Peptidoglycan-bd-like.
[Graphical view]
PANTHERiPTHR10201:SF26. PTHR10201:SF26. 1 hit.
PfamiPF11857. DUF3377. 1 hit.
PF00045. Hemopexin. 4 hits.
PF00413. Peptidase_M10. 1 hit.
PF01471. PG_binding_1. 1 hit.
[Graphical view]
PIRSFiPIRSF001191. Peptidase_M10A_matrix. 1 hit.
PRINTSiPR00138. MATRIXIN.
SMARTiSM00120. HX. 4 hits.
SM00235. ZnMc. 1 hit.
[Graphical view]
SUPFAMiSSF47090. SSF47090. 1 hit.
SSF50923. SSF50923. 1 hit.
PROSITEiPS00546. CYSTEINE_SWITCH. 1 hit.
PS00024. HEMOPEXIN. 1 hit.
PS51642. HEMOPEXIN_2. 4 hits.
PS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: O35548-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MILLAFSSGR RLDFVHRSGV FFFQTLLWIL CATVCGTEQY FNVEVWLQKY    50
GYLPPTDPRM SVLRSAETMQ SALAAMQQFY GINMTGKVDR NTIDWMKKPR 100
CGVPDQTRGS SKFNIRRKRY ALTGQKWQHK HITYSIKNVT PKVGDPETRR 150
AIRRAFDVWQ NVTPLTFEEV PYSELENGKR DVDITIIFAS GFHGDRSPFD 200
GEGGFLAHAY FPGPGIGGDT HFDSDEPWTL GNPNHDGNDL FLVAVHELGH 250
ALGLEHSNDP TAIMAPFYQY METDNFKLPN DDLQGIQKIY GPPDKIPPPT 300
RPLPTVPPHR SVPPADPRKN DRPKPPRPPT GRPSYPGAKP NICDGNFNTL 350
AILRREMFVF KDQWFWRVRN NRVMDGYPMQ ITYFWRGLPP SIDAVYENSD 400
GNFVFFKGNK YWVFKDTTLQ PGYPHDLITL GNGIPPHGID SAIWWEDVGK 450
TYFFKGDRYW RYSEEMKTMD PGYPKPITIW KGIPESPQGA FVHKENGFTY 500
FYKGKEYWKF NNQILKVEPG YPRSILKDFM GCDGPTDRDK EGLSPPDDVD 550
IVIKLDNTAS TVKAIAIVIP CILALCLLVL VYTVFQFKRK GTPRHILYCK 600
RSMQEWV 607
Length:607
Mass (Da):69,624
Last modified:January 1, 1998 - v1
Checksum:i86BBCF8063441653
GO
Isoform Short (identifier: O35548-2) [UniParc]FASTAAdd to Basket

Also known as: MT3-MMP-del

The sequence of this isoform differs from the canonical sequence as follows:
     547-607: DDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV → P

Show »
Length:547
Mass (Da):62,775
Checksum:i61CE63C123C3B9A5
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei547 – 60761DDVDI…MQEWV → P in isoform Short.
VSP_005455Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D85509 mRNA. Translation: BAA22224.1.
D63886 mRNA. Translation: BAA22223.1.
RefSeqiNP_542954.1. NM_080776.1. [O35548-2]
UniGeneiRn.208361.

Genome annotation databases

GeneIDi65205.
KEGGirno:65205.
UCSCiRGD:620199. rat. [O35548-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D85509 mRNA. Translation: BAA22224.1 .
D63886 mRNA. Translation: BAA22223.1 .
RefSeqi NP_542954.1. NM_080776.1. [O35548-2 ]
UniGenei Rn.208361.

3D structure databases

ProteinModelPortali O35548.
SMRi O35548. Positions 124-292.
ModBasei Search...

Protein family/group databases

MEROPSi M10.016.

PTM databases

PhosphoSitei O35548.

Proteomic databases

PaxDbi O35548.
PRIDEi O35548.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 65205.
KEGGi rno:65205.
UCSCi RGD:620199. rat. [O35548-1 ]

Organism-specific databases

CTDi 4325.
RGDi 620199. Mmp16.

Phylogenomic databases

eggNOGi NOG295915.
HOGENOMi HOG000217928.
HOVERGENi HBG052484.
KOi K07996.
PhylomeDBi O35548.

Miscellaneous databases

NextBioi 614169.
PROi O35548.

Gene expression databases

Genevestigatori O35548.

Family and domain databases

Gene3Di 2.110.10.10. 1 hit.
3.40.390.10. 1 hit.
InterProi IPR000585. Hemopexin-like_dom.
IPR018487. Hemopexin-like_repeat.
IPR018486. Hemopexin_CS.
IPR024079. MetalloPept_cat_dom.
IPR028697. MMP16.
IPR001818. Pept_M10_metallopeptidase.
IPR021190. Pept_M10A.
IPR021805. Pept_M10A_metallopeptidase_C.
IPR016293. Pept_M10A_stromelysin-type.
IPR021158. Pept_M10A_Zn_BS.
IPR006026. Peptidase_Metallo.
IPR002477. Peptidoglycan-bd-like.
[Graphical view ]
PANTHERi PTHR10201:SF26. PTHR10201:SF26. 1 hit.
Pfami PF11857. DUF3377. 1 hit.
PF00045. Hemopexin. 4 hits.
PF00413. Peptidase_M10. 1 hit.
PF01471. PG_binding_1. 1 hit.
[Graphical view ]
PIRSFi PIRSF001191. Peptidase_M10A_matrix. 1 hit.
PRINTSi PR00138. MATRIXIN.
SMARTi SM00120. HX. 4 hits.
SM00235. ZnMc. 1 hit.
[Graphical view ]
SUPFAMi SSF47090. SSF47090. 1 hit.
SSF50923. SSF50923. 1 hit.
PROSITEi PS00546. CYSTEINE_SWITCH. 1 hit.
PS00024. HEMOPEXIN. 1 hit.
PS51642. HEMOPEXIN_2. 4 hits.
PS00142. ZINC_PROTEASE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Expression of three membrane-type matrix metalloproteinases (MT-MMPs) in rat vascular smooth muscle cells and characterization of MT3-MMPs with and without transmembrane domain."
    Shofuda K., Yasumitsu H., Nishihashi A., Miki K., Miyazaki K.
    J. Biol. Chem. 272:9749-9754(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    Tissue: Smooth muscle.

Entry informationi

Entry nameiMMP16_RAT
AccessioniPrimary (citable) accession number: O35548
Secondary accession number(s): O35541
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 1, 1998
Last modified: June 11, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3
Error
SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

500 Internal Server Error

The server was not able to handle your request.

If this error occurs repeatedly, please contact us and indicate the page you were trying to access.