O35548 (MMP16_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Matrix metalloproteinase-16 Short name=MMP-16 EC=3.4.24.- Alternative name(s): Membrane-type matrix metalloproteinase 3 Short name=MT-MMP 3 Short name=MTMMP3 Membrane-type-3 matrix metalloproteinase Short name=MT3-MMP Short name=MT3MMP | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 607 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Endopeptidase that degrades various components of the extracellular matrix, such as collagen type III and fibronectin. Activates progelatinase A. Involved in the matrix remodeling of blood vessels. The short isoform efficiently converts progelatinase A to the intermediate form but not to the mature one. It has no effect on type I, II, IV and V collagen. However, upon interaction with CSPG4, it may be involved in degradation and invasion of type I collagen by melanoma cells. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. Calcium By similarity. |
| Subunit structure | Interacts with CSPG4 through CSPG4 chondroitin sulfate glycosaminoglycan By similarity. |
| Subcellular location | Cell membrane; Single-pass type I membrane protein; Extracellular side Potential. Note: Localized at the cell surface of melanoma cells By similarity. Isoform Short: Secreted › extracellular space › extracellular matrix. |
| Tissue specificity | Strongly expressed in the lung, brain and smooth muscle cells. Weakly detectable in the spleen and liver and indetectable in the heart, skeletal muscle and kidney. |
| Domain | The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. |
| Post-translational modification | The precursor is cleaved by a furin endopeptidase By similarity. |
| Sequence similarities | Belongs to the peptidase M10A family. Contains 4 hemopexin-like domains. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: O35548-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: O35548-2) Also known as: MT3-MMP-del; The sequence of this isoform differs from the canonical sequence as follows: 547-607: DDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV → P |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | Potential | ||||||||
| Propeptide | 32 – 119 | 88 | By similarity | PRO_0000028816 | |||||||
| Chain | 120 – 607 | 488 | Matrix metalloproteinase-16 | PRO_0000028817 | |||||||
Regions | |||||||||||
| Topological domain | 120 – 564 | 445 | Extracellular Potential | ||||||||
| Transmembrane | 565 – 585 | 21 | Helical; Potential | ||||||||
| Topological domain | 586 – 607 | 22 | Cytoplasmic Potential | ||||||||
| Domain | 347 – 390 | 44 | Hemopexin-like 1 | ||||||||
| Domain | 392 – 436 | 45 | Hemopexin-like 2 | ||||||||
| Domain | 439 – 485 | 47 | Hemopexin-like 3 | ||||||||
| Domain | 487 – 532 | 46 | Hemopexin-like 4 | ||||||||
| Motif | 99 – 106 | 8 | Cysteine switch By similarity | ||||||||
Sites | |||||||||||
| Active site | 247 | 1 | By similarity | ||||||||
| Metal binding | 101 | 1 | Zinc 1; in inhibited form By similarity | ||||||||
| Metal binding | 183 | 1 | Calcium 1; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 193 | 1 | Zinc 1 By similarity | ||||||||
| Metal binding | 195 | 1 | Zinc 1 By similarity | ||||||||
| Metal binding | 200 | 1 | Calcium 2 By similarity | ||||||||
| Metal binding | 201 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 203 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 205 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 215 | 1 | Calcium 1; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 217 | 1 | Calcium 1; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 219 | 1 | Calcium 1 By similarity | ||||||||
| Metal binding | 223 | 1 | Calcium 2 By similarity | ||||||||
| Metal binding | 226 | 1 | Calcium 2 By similarity | ||||||||
| Metal binding | 246 | 1 | Zinc 2; catalytic By similarity | ||||||||
| Metal binding | 250 | 1 | Zinc 2; catalytic By similarity | ||||||||
| Metal binding | 256 | 1 | Zinc 2; catalytic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 83 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 343 ↔ 532 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 547 – 607 | 61 | DDVDI…MQEWV → P in isoform Short. | VSP_005455 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Expression of three membrane-type matrix metalloproteinases (MT-MMPs) in rat vascular smooth muscle cells and characterization of MT3-MMPs with and without transmembrane domain." Shofuda K., Yasumitsu H., Nishihashi A., Miki K., Miyazaki K. J. Biol. Chem. 272:9749-9754(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. Tissue: Smooth muscle. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D85509 mRNA. Translation: BAA22224.1. D63886 mRNA. Translation: BAA22223.1. |
| IPI | IPI00210507. IPI00324046. |
| RefSeq | NP_542954.1. NM_080776.1. |
| UniGene | Rn.208361. |
3D structure databases | |
| ProteinModelPortal | O35548. |
| SMR | O35548. Positions 124-292. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | M10.016. |
PTM databases | |
| PhosphoSite | O35548. |
Proteomic databases | |
| PaxDb | O35548. |
| PRIDE | O35548. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 65205. |
| KEGG | rno:65205. |
| UCSC | RGD:620199. rat. |
Organism-specific databases | |
| CTD | 4325. |
| RGD | 620199. Mmp16. |
Phylogenomic databases | |
| eggNOG | NOG295915. |
| HOGENOM | HOG000217928. |
| HOVERGEN | HBG052484. |
| KO | K07996. |
| OrthoDB | EOG4R5029. |
Gene expression databases | |
| ArrayExpress | O35548. |
| Genevestigator | O35548. |
Family and domain databases | |
| Gene3D | 2.110.10.10. 1 hit. 3.40.390.10. 1 hit. |
| InterPro | IPR000585. Hemopexin-like_dom. IPR018487. Hemopexin-like_repeat. IPR018486. Hemopexin_CS. IPR024079. MetalloPept_cat_dom. IPR001818. Pept_M10_metallopeptidase. IPR021190. Pept_M10A. IPR021805. Pept_M10A_metallopeptidase_C. IPR016293. Pept_M10A_Metazoans. IPR021158. Pept_M10A_Zn_BS. IPR006026. Peptidase_Metallo. IPR002477. Peptidoglycan-bd-like. [Graphical view] |
| Pfam | PF11857. DUF3377. 1 hit. PF00045. Hemopexin. 4 hits. PF00413. Peptidase_M10. 1 hit. PF01471. PG_binding_1. 1 hit. [Graphical view] |
| PIRSF | PIRSF001191. Peptidase_M10A_matrix. 1 hit. |
| PRINTS | PR00138. MATRIXIN. |
| SMART | SM00120. HX. 4 hits. SM00235. ZnMc. 1 hit. [Graphical view] |
| SUPFAM | SSF50923. Hemopexin. 1 hit. SSF47090. PGBD_like. 1 hit. |
| PROSITE | PS00546. CYSTEINE_SWITCH. 1 hit. PS00024. HEMOPEXIN. 1 hit. PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 614169. |
Entry information
| Entry name | MMP16_RAT | ||||||||
| Accession | Primary (citable) accession number: O35548 Secondary accession number(s): O35541 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with
