O35400 (ST2B1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sulfotransferase family cytosolic 2B member 1 Short name=ST2B1 Short name=Sulfotransferase 2B1 EC=2.8.2.2 Alternative name(s): Alcohol sulfotransferase Hydroxysteroid sulfotransferase 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 338 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids such as dehydroepiandrosterone. Isoform 1 is required for production of cholesterol sulfate essential for normal skin development whereas isoform 2 produces pregnenolone sulfate, an essential neurosteroid during development of the central nervous system. |
| Catalytic activity | 3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate. |
| Subcellular location | |
| Tissue specificity | Expressed at high levels in epididymis, intestine and uterus, and low levels in brain and hypothalamus. Isoform 2 is most prominent in the brain and spinal cord, with modest expression in the lung, skin and spleen. Isoform 1 is most prominently expressed in skin and small intestine, with modest expression in muscle and prostate. Ref.1 Ref.2 |
| Developmental stage | Isoform 1 and isoform 2 are expressed from stages E8.5-E19 embryo. Ref.2 |
| Sequence similarities | Belongs to the sulfotransferase 1 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid metabolism Steroid metabolism |
| Cellular component | Cytoplasm Endoplasmic reticulum Microsome |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | steroid metabolic process Inferred from electronic annotation. Source: UniProtKB-KW sulfate assimilationInferred from direct assay Ref.1. Source: MGI |
| Cellular_component | endoplasmic reticulum Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | alcohol sulfotransferase activity Inferred from electronic annotation. Source: EC steroid sulfotransferase activityInferred from electronic annotation. Source: Compara sulfotransferase activityInferred from direct assay Ref.1. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O35400-1) Also known as: SULT2B1b; B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O35400-2) Also known as: SULT2B1a; A; The sequence of this isoform differs from the canonical sequence as follows: 1-20: MDGPQPRALWSSSEKNVSEM → MTSRDCCCGGVEVDLLLRWTHGAQRKDTPHWRVNEGPCDSCPPPWSSLHVPFPSF | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 338 | 338 | Sulfotransferase family cytosolic 2B member 1 | PRO_0000085150 | |||||
Regions | |||||||||
| Nucleotide binding | 67 – 72 | 6 | PAPS By similarity | ||||||
| Nucleotide binding | 241 – 246 | 6 | PAPS By similarity | ||||||
| Nucleotide binding | 271 – 273 | 3 | PAPS By similarity | ||||||
Sites | |||||||||
| Active site | 122 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 95 | 1 | Substrate By similarity | ||||||
| Binding site | 100 | 1 | Substrate By similarity | ||||||
| Binding site | 144 | 1 | PAPS By similarity | ||||||
| Binding site | 152 | 1 | PAPS By similarity | ||||||
| Binding site | 207 | 1 | PAPS By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 20 | 20 | MDGPQ…NVSEM → MTSRDCCCGGVEVDLLLRWT HGAQRKDTPHWRVNEGPCDS CPPPWSSLHVPFPSF in isoform 2. | VSP_012511 | |||||
Experimental info | |||||||||
| Sequence conflict | 329 | 1 | S → F in AAC69918. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning, expression, and functional characterization of novel mouse sulfotransferases." Sakakibara Y., Yanagisawa K., Takami Y., Nakayama T., Suiko M., Liu M.-C. Biochem. Biophys. Res. Commun. 247:681-686(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Conservation of the hydroxysteroid sulfotransferase SULT2B1 gene structure in the mouse: pre- and postnatal expression, kinetic analysis of isoforms, and comparison with prototypical SULT2A1." Shimizu C., Fuda H., Yanai H., Strott C.A. Endocrinology 144:1186-1193(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY. Strain: C57BL/6. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J, Czech II and FVB/N. Tissue: Mammary gland. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF026072 mRNA. Translation: AAC69918.1. AF478566 mRNA. Translation: AAM46788.1. BC009811 mRNA. Translation: AAH09811.1. BC009813 mRNA. Translation: AAH09813.1. |
| IPI | IPI00130613. IPI00322602. |
| PIR | JE0196. |
| RefSeq | NP_059493.2. NM_017465.2. |
| UniGene | Mm.271634. |
3D structure databases | |
| ProteinModelPortal | O35400. |
| SMR | O35400. Positions 26-307. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | O35400. |
Proteomic databases | |
| PaxDb | O35400. |
| PRIDE | O35400. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000075571; ENSMUSP00000075005; ENSMUSG00000003271. |
| GeneID | 54200. |
| KEGG | mmu:54200. |
| UCSC | uc009gxa.1. mouse. uc009gxb.2. mouse. |
Organism-specific databases | |
| CTD | 6820. |
| MGI | MGI:1926342. Sult2b1. |
Phylogenomic databases | |
| eggNOG | NOG296990. |
| GeneTree | ENSGT00670000097842. |
| HOGENOM | HOG000037209. |
| HOVERGEN | HBG001195. |
| KO | K01015. |
| OrthoDB | EOG4NS3CD. |
Enzyme and pathway databases | |
| BRENDA | 2.8.2.2. 3474. |
Gene expression databases | |
| ArrayExpress | O35400. |
| Bgee | O35400. |
| CleanEx | MM_SULT2B1. |
| Genevestigator | O35400. |
| GermOnline | ENSMUSG00000003271. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000863. Sulfotransferase_dom. [Graphical view] |
| Pfam | PF00685. Sulfotransfer_1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 311058. |
| SOURCE | Search... |
Entry information
| Entry name | ST2B1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O35400 Secondary accession number(s): Q8K472, Q91V03 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
