Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfotransferase family cytosolic 2B member 1

Gene

Sult2b1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids such as dehydroepiandrosterone. Isoform 1 is required for production of cholesterol sulfate essential for normal skin development whereas isoform 2 produces pregnenolone sulfate, an essential neurosteroid during development of the central nervous system.

Catalytic activityi

3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei95 – 951SubstrateBy similarity
Binding sitei100 – 1001SubstrateBy similarity
Active sitei122 – 1221Proton acceptorBy similarity
Binding sitei144 – 1441PAPSBy similarity
Binding sitei152 – 1521PAPSBy similarity
Binding sitei207 – 2071PAPSBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi67 – 726PAPSBy similarity
Nucleotide bindingi241 – 2466PAPSBy similarity
Nucleotide bindingi271 – 2733PAPSBy similarity

GO - Molecular functioni

GO - Biological processi

  • steroid metabolic process Source: MGI
  • sulfate assimilation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Lipid metabolism, Steroid metabolism

Enzyme and pathway databases

BRENDAi2.8.2.2. 3474.
ReactomeiREACT_309610. Cytosolic sulfonation of small molecules.

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfotransferase family cytosolic 2B member 1 (EC:2.8.2.2)
Short name:
ST2B1
Short name:
Sulfotransferase 2B1
Alternative name(s):
Alcohol sulfotransferase
Hydroxysteroid sulfotransferase 2
Gene namesi
Name:Sult2b1
Synonyms:Sult2b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1926342. Sult2b1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Microsome

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 338338Sulfotransferase family cytosolic 2B member 1PRO_0000085150Add
BLAST

Proteomic databases

MaxQBiO35400.
PaxDbiO35400.
PRIDEiO35400.

PTM databases

PhosphoSiteiO35400.

Expressioni

Tissue specificityi

Expressed at high levels in epididymis, intestine and uterus, and low levels in brain and hypothalamus. Isoform 2 is most prominent in the brain and spinal cord, with modest expression in the lung, skin and spleen. Isoform 1 is most prominently expressed in skin and small intestine, with modest expression in muscle and prostate.2 Publications

Developmental stagei

Isoform 1 and isoform 2 are expressed from stages E8.5-E19 embryo.1 Publication

Gene expression databases

BgeeiO35400.
CleanExiMM_SULT2B1.
ExpressionAtlasiO35400. baseline and differential.
GenevisibleiO35400. MM.

Interactioni

Protein-protein interaction databases

IntActiO35400. 7 interactions.
STRINGi10090.ENSMUSP00000075005.

Structurei

3D structure databases

ProteinModelPortaliO35400.
SMRiO35400. Positions 26-307.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the sulfotransferase 1 family.Curated

Phylogenomic databases

eggNOGiNOG296990.
GeneTreeiENSGT00760000118932.
HOGENOMiHOG000037209.
HOVERGENiHBG001195.
InParanoidiO35400.
KOiK01015.
OrthoDBiEOG7V49ZK.
PhylomeDBiO35400.
TreeFamiTF321745.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamiPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O35400-1) [UniParc]FASTAAdd to basket

Also known as: SULT2B1b, B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDGPQPRALW SSSEKNVSEM SWNFGGEYFR YKGIPFPVGM YSPESLSLAE
60 70 80 90 100
NTSNVRDDDI FIVTYPKSGT NWMIEIVCLI LKDGDPSWIR SEPIWQRAPW
110 120 130 140 150
CETIISAFNV LDRPSPRIMS SHLPIELFTK AFFSSKAKVI YVGRNPRDVV
160 170 180 190 200
VSLYYYSKIA GQLKDPGTPD QFLQNFLKGE VQFGSWFDHI KGWIRMQNQE
210 220 230 240 250
NFLFITYEEL QQDLRGSVQR ICEFLGRPLG EEALSSVVAH SAFAAMKANT
260 270 280 290 300
MSNYSLLPAS LLDHRQGEFL RKGISGDWKN HFTVAQSEAF DSVYREQMHG
310 320 330
VQRFPWDTSE EDSSPDGQPD PEPSPSPASD DPNPGSSQ
Length:338
Mass (Da):38,347
Last modified:January 4, 2005 - v2
Checksum:iEA21BAB0917034C1
GO
Isoform 2 (identifier: O35400-2) [UniParc]FASTAAdd to basket

Also known as: SULT2B1a, A

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDGPQPRALWSSSEKNVSEM → MTSRDCCCGGVEVDLLLRWTHGAQRKDTPHWRVNEGPCDSCPPPWSSLHVPFPSF

Note: No experimental confirmation available.
Show »
Length:373
Mass (Da):42,308
Checksum:i8C4B1076532EFD4C
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti329 – 3291S → F in AAC69918 (PubMed:9647753).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2020MDGPQ…NVSEM → MTSRDCCCGGVEVDLLLRWT HGAQRKDTPHWRVNEGPCDS CPPPWSSLHVPFPSF in isoform 2. 1 PublicationVSP_012511Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF026072 mRNA. Translation: AAC69918.1.
AF478566 mRNA. Translation: AAM46788.1.
BC009811 mRNA. Translation: AAH09811.1.
BC009813 mRNA. Translation: AAH09813.1.
CCDSiCCDS21263.1. [O35400-1]
PIRiJE0196.
RefSeqiNP_059493.2. NM_017465.2. [O35400-1]
UniGeneiMm.271634.

Genome annotation databases

EnsembliENSMUST00000075571; ENSMUSP00000075005; ENSMUSG00000003271. [O35400-1]
GeneIDi54200.
KEGGimmu:54200.
UCSCiuc009gxb.2. mouse. [O35400-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF026072 mRNA. Translation: AAC69918.1.
AF478566 mRNA. Translation: AAM46788.1.
BC009811 mRNA. Translation: AAH09811.1.
BC009813 mRNA. Translation: AAH09813.1.
CCDSiCCDS21263.1. [O35400-1]
PIRiJE0196.
RefSeqiNP_059493.2. NM_017465.2. [O35400-1]
UniGeneiMm.271634.

3D structure databases

ProteinModelPortaliO35400.
SMRiO35400. Positions 26-307.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO35400. 7 interactions.
STRINGi10090.ENSMUSP00000075005.

PTM databases

PhosphoSiteiO35400.

Proteomic databases

MaxQBiO35400.
PaxDbiO35400.
PRIDEiO35400.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000075571; ENSMUSP00000075005; ENSMUSG00000003271. [O35400-1]
GeneIDi54200.
KEGGimmu:54200.
UCSCiuc009gxb.2. mouse. [O35400-1]

Organism-specific databases

CTDi6820.
MGIiMGI:1926342. Sult2b1.

Phylogenomic databases

eggNOGiNOG296990.
GeneTreeiENSGT00760000118932.
HOGENOMiHOG000037209.
HOVERGENiHBG001195.
InParanoidiO35400.
KOiK01015.
OrthoDBiEOG7V49ZK.
PhylomeDBiO35400.
TreeFamiTF321745.

Enzyme and pathway databases

BRENDAi2.8.2.2. 3474.
ReactomeiREACT_309610. Cytosolic sulfonation of small molecules.

Miscellaneous databases

NextBioi311058.
PROiO35400.
SOURCEiSearch...

Gene expression databases

BgeeiO35400.
CleanExiMM_SULT2B1.
ExpressionAtlasiO35400. baseline and differential.
GenevisibleiO35400. MM.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamiPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning, expression, and functional characterization of novel mouse sulfotransferases."
    Sakakibara Y., Yanagisawa K., Takami Y., Nakayama T., Suiko M., Liu M.-C.
    Biochem. Biophys. Res. Commun. 247:681-686(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Conservation of the hydroxysteroid sulfotransferase SULT2B1 gene structure in the mouse: pre- and postnatal expression, kinetic analysis of isoforms, and comparison with prototypical SULT2A1."
    Shimizu C., Fuda H., Yanai H., Strott C.A.
    Endocrinology 144:1186-1193(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
    Strain: C57BL/6.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J, Czech II and FVB/N.
    Tissue: Mammary gland.

Entry informationi

Entry nameiST2B1_MOUSE
AccessioniPrimary (citable) accession number: O35400
Secondary accession number(s): Q8K472, Q91V03
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: January 4, 2005
Last modified: June 24, 2015
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.