SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O35400

- ST2B1_MOUSE

UniProt

O35400 - ST2B1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Sulfotransferase family cytosolic 2B member 1
Gene
Sult2b1, Sult2b
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids such as dehydroepiandrosterone. Isoform 1 is required for production of cholesterol sulfate essential for normal skin development whereas isoform 2 produces pregnenolone sulfate, an essential neurosteroid during development of the central nervous system.

Catalytic activityi

3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei95 – 951Substrate By similarity
Binding sitei100 – 1001Substrate By similarity
Active sitei122 – 1221Proton acceptor By similarity
Binding sitei144 – 1441PAPS By similarity
Binding sitei152 – 1521PAPS By similarity
Binding sitei207 – 2071PAPS By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi67 – 726PAPS By similarity
Nucleotide bindingi241 – 2466PAPS By similarity
Nucleotide bindingi271 – 2733PAPS By similarity

GO - Molecular functioni

  1. alcohol sulfotransferase activity Source: UniProtKB-EC
  2. steroid sulfotransferase activity Source: Ensembl
  3. sulfotransferase activity Source: MGI

GO - Biological processi

  1. steroid metabolic process Source: UniProtKB-KW
  2. sulfate assimilation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Lipid metabolism, Steroid metabolism

Enzyme and pathway databases

BRENDAi2.8.2.2. 3474.

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfotransferase family cytosolic 2B member 1 (EC:2.8.2.2)
Short name:
ST2B1
Short name:
Sulfotransferase 2B1
Alternative name(s):
Alcohol sulfotransferase
Hydroxysteroid sulfotransferase 2
Gene namesi
Name:Sult2b1
Synonyms:Sult2b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 7

Organism-specific databases

MGIiMGI:1926342. Sult2b1.

Subcellular locationi

Cytoplasm By similarity. Microsome By similarity

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Microsome

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 338338Sulfotransferase family cytosolic 2B member 1
PRO_0000085150Add
BLAST

Proteomic databases

MaxQBiO35400.
PaxDbiO35400.
PRIDEiO35400.

PTM databases

PhosphoSiteiO35400.

Expressioni

Tissue specificityi

Expressed at high levels in epididymis, intestine and uterus, and low levels in brain and hypothalamus. Isoform 2 is most prominent in the brain and spinal cord, with modest expression in the lung, skin and spleen. Isoform 1 is most prominently expressed in skin and small intestine, with modest expression in muscle and prostate.2 Publications

Developmental stagei

Isoform 1 and isoform 2 are expressed from stages E8.5-E19 embryo.1 Publication

Gene expression databases

ArrayExpressiO35400.
BgeeiO35400.
CleanExiMM_SULT2B1.
GenevestigatoriO35400.

Interactioni

Protein-protein interaction databases

IntActiO35400. 7 interactions.

Structurei

3D structure databases

ProteinModelPortaliO35400.
SMRiO35400. Positions 26-307.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG296990.
GeneTreeiENSGT00670000097842.
HOGENOMiHOG000037209.
HOVERGENiHBG001195.
KOiK01015.
OrthoDBiEOG7V49ZK.
PhylomeDBiO35400.
TreeFamiTF321745.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamiPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O35400-1) [UniParc]FASTAAdd to Basket

Also known as: SULT2B1b, B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDGPQPRALW SSSEKNVSEM SWNFGGEYFR YKGIPFPVGM YSPESLSLAE    50
NTSNVRDDDI FIVTYPKSGT NWMIEIVCLI LKDGDPSWIR SEPIWQRAPW 100
CETIISAFNV LDRPSPRIMS SHLPIELFTK AFFSSKAKVI YVGRNPRDVV 150
VSLYYYSKIA GQLKDPGTPD QFLQNFLKGE VQFGSWFDHI KGWIRMQNQE 200
NFLFITYEEL QQDLRGSVQR ICEFLGRPLG EEALSSVVAH SAFAAMKANT 250
MSNYSLLPAS LLDHRQGEFL RKGISGDWKN HFTVAQSEAF DSVYREQMHG 300
VQRFPWDTSE EDSSPDGQPD PEPSPSPASD DPNPGSSQ 338
Length:338
Mass (Da):38,347
Last modified:January 4, 2005 - v2
Checksum:iEA21BAB0917034C1
GO
Isoform 2 (identifier: O35400-2) [UniParc]FASTAAdd to Basket

Also known as: SULT2B1a, A

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDGPQPRALWSSSEKNVSEM → MTSRDCCCGGVEVDLLLRWTHGAQRKDTPHWRVNEGPCDSCPPPWSSLHVPFPSF

Note: No experimental confirmation available.

Show »
Length:373
Mass (Da):42,308
Checksum:i8C4B1076532EFD4C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2020MDGPQ…NVSEM → MTSRDCCCGGVEVDLLLRWT HGAQRKDTPHWRVNEGPCDS CPPPWSSLHVPFPSF in isoform 2.
VSP_012511Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti329 – 3291S → F in AAC69918. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF026072 mRNA. Translation: AAC69918.1.
AF478566 mRNA. Translation: AAM46788.1.
BC009811 mRNA. Translation: AAH09811.1.
BC009813 mRNA. Translation: AAH09813.1.
CCDSiCCDS21263.1. [O35400-1]
PIRiJE0196.
RefSeqiNP_059493.2. NM_017465.2. [O35400-1]
UniGeneiMm.271634.

Genome annotation databases

EnsembliENSMUST00000075571; ENSMUSP00000075005; ENSMUSG00000003271. [O35400-1]
GeneIDi54200.
KEGGimmu:54200.
UCSCiuc009gxb.2. mouse. [O35400-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF026072 mRNA. Translation: AAC69918.1 .
AF478566 mRNA. Translation: AAM46788.1 .
BC009811 mRNA. Translation: AAH09811.1 .
BC009813 mRNA. Translation: AAH09813.1 .
CCDSi CCDS21263.1. [O35400-1 ]
PIRi JE0196.
RefSeqi NP_059493.2. NM_017465.2. [O35400-1 ]
UniGenei Mm.271634.

3D structure databases

ProteinModelPortali O35400.
SMRi O35400. Positions 26-307.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi O35400. 7 interactions.

PTM databases

PhosphoSitei O35400.

Proteomic databases

MaxQBi O35400.
PaxDbi O35400.
PRIDEi O35400.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000075571 ; ENSMUSP00000075005 ; ENSMUSG00000003271 . [O35400-1 ]
GeneIDi 54200.
KEGGi mmu:54200.
UCSCi uc009gxb.2. mouse. [O35400-1 ]

Organism-specific databases

CTDi 6820.
MGIi MGI:1926342. Sult2b1.

Phylogenomic databases

eggNOGi NOG296990.
GeneTreei ENSGT00670000097842.
HOGENOMi HOG000037209.
HOVERGENi HBG001195.
KOi K01015.
OrthoDBi EOG7V49ZK.
PhylomeDBi O35400.
TreeFami TF321745.

Enzyme and pathway databases

BRENDAi 2.8.2.2. 3474.

Miscellaneous databases

NextBioi 311058.
PROi O35400.
SOURCEi Search...

Gene expression databases

ArrayExpressi O35400.
Bgeei O35400.
CleanExi MM_SULT2B1.
Genevestigatori O35400.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view ]
Pfami PF00685. Sulfotransfer_1. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning, expression, and functional characterization of novel mouse sulfotransferases."
    Sakakibara Y., Yanagisawa K., Takami Y., Nakayama T., Suiko M., Liu M.-C.
    Biochem. Biophys. Res. Commun. 247:681-686(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Conservation of the hydroxysteroid sulfotransferase SULT2B1 gene structure in the mouse: pre- and postnatal expression, kinetic analysis of isoforms, and comparison with prototypical SULT2A1."
    Shimizu C., Fuda H., Yanai H., Strott C.A.
    Endocrinology 144:1186-1193(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
    Strain: C57BL/6.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J, Czech II and FVB/N.
    Tissue: Mammary gland.

Entry informationi

Entry nameiST2B1_MOUSE
AccessioniPrimary (citable) accession number: O35400
Secondary accession number(s): Q8K472, Q91V03
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: January 4, 2005
Last modified: July 9, 2014
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi