Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O35400

- ST2B1_MOUSE

UniProt

O35400 - ST2B1_MOUSE

Protein

Sulfotransferase family cytosolic 2B member 1

Gene

Sult2b1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 108 (01 Oct 2014)
      Sequence version 2 (04 Jan 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids such as dehydroepiandrosterone. Isoform 1 is required for production of cholesterol sulfate essential for normal skin development whereas isoform 2 produces pregnenolone sulfate, an essential neurosteroid during development of the central nervous system.

    Catalytic activityi

    3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei95 – 951SubstrateBy similarity
    Binding sitei100 – 1001SubstrateBy similarity
    Active sitei122 – 1221Proton acceptorBy similarity
    Binding sitei144 – 1441PAPSBy similarity
    Binding sitei152 – 1521PAPSBy similarity
    Binding sitei207 – 2071PAPSBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi67 – 726PAPSBy similarity
    Nucleotide bindingi241 – 2466PAPSBy similarity
    Nucleotide bindingi271 – 2733PAPSBy similarity

    GO - Molecular functioni

    1. alcohol sulfotransferase activity Source: UniProtKB-EC
    2. steroid sulfotransferase activity Source: Ensembl
    3. sulfotransferase activity Source: MGI

    GO - Biological processi

    1. steroid metabolic process Source: UniProtKB-KW
    2. sulfate assimilation Source: MGI

    Keywords - Molecular functioni

    Transferase

    Keywords - Biological processi

    Lipid metabolism, Steroid metabolism

    Enzyme and pathway databases

    BRENDAi2.8.2.2. 3474.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sulfotransferase family cytosolic 2B member 1 (EC:2.8.2.2)
    Short name:
    ST2B1
    Short name:
    Sulfotransferase 2B1
    Alternative name(s):
    Alcohol sulfotransferase
    Hydroxysteroid sulfotransferase 2
    Gene namesi
    Name:Sult2b1
    Synonyms:Sult2b
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 7

    Organism-specific databases

    MGIiMGI:1926342. Sult2b1.

    Subcellular locationi

    Cytoplasm By similarity. Microsome By similarity

    GO - Cellular componenti

    1. endoplasmic reticulum Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cytoplasm, Endoplasmic reticulum, Microsome

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 338338Sulfotransferase family cytosolic 2B member 1PRO_0000085150Add
    BLAST

    Proteomic databases

    MaxQBiO35400.
    PaxDbiO35400.
    PRIDEiO35400.

    PTM databases

    PhosphoSiteiO35400.

    Expressioni

    Tissue specificityi

    Expressed at high levels in epididymis, intestine and uterus, and low levels in brain and hypothalamus. Isoform 2 is most prominent in the brain and spinal cord, with modest expression in the lung, skin and spleen. Isoform 1 is most prominently expressed in skin and small intestine, with modest expression in muscle and prostate.2 Publications

    Developmental stagei

    Isoform 1 and isoform 2 are expressed from stages E8.5-E19 embryo.1 Publication

    Gene expression databases

    ArrayExpressiO35400.
    BgeeiO35400.
    CleanExiMM_SULT2B1.
    GenevestigatoriO35400.

    Interactioni

    Protein-protein interaction databases

    IntActiO35400. 7 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliO35400.
    SMRiO35400. Positions 26-307.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the sulfotransferase 1 family.Curated

    Phylogenomic databases

    eggNOGiNOG296990.
    GeneTreeiENSGT00670000097842.
    HOGENOMiHOG000037209.
    HOVERGENiHBG001195.
    KOiK01015.
    OrthoDBiEOG7V49ZK.
    PhylomeDBiO35400.
    TreeFamiTF321745.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR027417. P-loop_NTPase.
    IPR000863. Sulfotransferase_dom.
    [Graphical view]
    PfamiPF00685. Sulfotransfer_1. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O35400-1) [UniParc]FASTAAdd to Basket

    Also known as: SULT2B1b, B

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDGPQPRALW SSSEKNVSEM SWNFGGEYFR YKGIPFPVGM YSPESLSLAE    50
    NTSNVRDDDI FIVTYPKSGT NWMIEIVCLI LKDGDPSWIR SEPIWQRAPW 100
    CETIISAFNV LDRPSPRIMS SHLPIELFTK AFFSSKAKVI YVGRNPRDVV 150
    VSLYYYSKIA GQLKDPGTPD QFLQNFLKGE VQFGSWFDHI KGWIRMQNQE 200
    NFLFITYEEL QQDLRGSVQR ICEFLGRPLG EEALSSVVAH SAFAAMKANT 250
    MSNYSLLPAS LLDHRQGEFL RKGISGDWKN HFTVAQSEAF DSVYREQMHG 300
    VQRFPWDTSE EDSSPDGQPD PEPSPSPASD DPNPGSSQ 338
    Length:338
    Mass (Da):38,347
    Last modified:January 4, 2005 - v2
    Checksum:iEA21BAB0917034C1
    GO
    Isoform 2 (identifier: O35400-2) [UniParc]FASTAAdd to Basket

    Also known as: SULT2B1a, A

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MDGPQPRALWSSSEKNVSEM → MTSRDCCCGGVEVDLLLRWTHGAQRKDTPHWRVNEGPCDSCPPPWSSLHVPFPSF

    Note: No experimental confirmation available.

    Show »
    Length:373
    Mass (Da):42,308
    Checksum:i8C4B1076532EFD4C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti329 – 3291S → F in AAC69918. (PubMed:9647753)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2020MDGPQ…NVSEM → MTSRDCCCGGVEVDLLLRWT HGAQRKDTPHWRVNEGPCDS CPPPWSSLHVPFPSF in isoform 2. 1 PublicationVSP_012511Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF026072 mRNA. Translation: AAC69918.1.
    AF478566 mRNA. Translation: AAM46788.1.
    BC009811 mRNA. Translation: AAH09811.1.
    BC009813 mRNA. Translation: AAH09813.1.
    CCDSiCCDS21263.1. [O35400-1]
    PIRiJE0196.
    RefSeqiNP_059493.2. NM_017465.2. [O35400-1]
    UniGeneiMm.271634.

    Genome annotation databases

    EnsembliENSMUST00000075571; ENSMUSP00000075005; ENSMUSG00000003271. [O35400-1]
    GeneIDi54200.
    KEGGimmu:54200.
    UCSCiuc009gxb.2. mouse. [O35400-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF026072 mRNA. Translation: AAC69918.1 .
    AF478566 mRNA. Translation: AAM46788.1 .
    BC009811 mRNA. Translation: AAH09811.1 .
    BC009813 mRNA. Translation: AAH09813.1 .
    CCDSi CCDS21263.1. [O35400-1 ]
    PIRi JE0196.
    RefSeqi NP_059493.2. NM_017465.2. [O35400-1 ]
    UniGenei Mm.271634.

    3D structure databases

    ProteinModelPortali O35400.
    SMRi O35400. Positions 26-307.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi O35400. 7 interactions.

    PTM databases

    PhosphoSitei O35400.

    Proteomic databases

    MaxQBi O35400.
    PaxDbi O35400.
    PRIDEi O35400.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000075571 ; ENSMUSP00000075005 ; ENSMUSG00000003271 . [O35400-1 ]
    GeneIDi 54200.
    KEGGi mmu:54200.
    UCSCi uc009gxb.2. mouse. [O35400-1 ]

    Organism-specific databases

    CTDi 6820.
    MGIi MGI:1926342. Sult2b1.

    Phylogenomic databases

    eggNOGi NOG296990.
    GeneTreei ENSGT00670000097842.
    HOGENOMi HOG000037209.
    HOVERGENi HBG001195.
    KOi K01015.
    OrthoDBi EOG7V49ZK.
    PhylomeDBi O35400.
    TreeFami TF321745.

    Enzyme and pathway databases

    BRENDAi 2.8.2.2. 3474.

    Miscellaneous databases

    NextBioi 311058.
    PROi O35400.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O35400.
    Bgeei O35400.
    CleanExi MM_SULT2B1.
    Genevestigatori O35400.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR027417. P-loop_NTPase.
    IPR000863. Sulfotransferase_dom.
    [Graphical view ]
    Pfami PF00685. Sulfotransfer_1. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning, expression, and functional characterization of novel mouse sulfotransferases."
      Sakakibara Y., Yanagisawa K., Takami Y., Nakayama T., Suiko M., Liu M.-C.
      Biochem. Biophys. Res. Commun. 247:681-686(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. "Conservation of the hydroxysteroid sulfotransferase SULT2B1 gene structure in the mouse: pre- and postnatal expression, kinetic analysis of isoforms, and comparison with prototypical SULT2A1."
      Shimizu C., Fuda H., Yanai H., Strott C.A.
      Endocrinology 144:1186-1193(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
      Strain: C57BL/6.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J, Czech II and FVB/N.
      Tissue: Mammary gland.

    Entry informationi

    Entry nameiST2B1_MOUSE
    AccessioniPrimary (citable) accession number: O35400
    Secondary accession number(s): Q8K472, Q91V03
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 4, 2005
    Last sequence update: January 4, 2005
    Last modified: October 1, 2014
    This is version 108 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3