Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O35400 (ST2B1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sulfotransferase family cytosolic 2B member 1

Short name=ST2B1
Short name=Sulfotransferase 2B1
EC=2.8.2.2
Alternative name(s):
Alcohol sulfotransferase
Hydroxysteroid sulfotransferase 2
Gene names
Name:Sult2b1
Synonyms:Sult2b
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length338 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids such as dehydroepiandrosterone. Isoform 1 is required for production of cholesterol sulfate essential for normal skin development whereas isoform 2 produces pregnenolone sulfate, an essential neurosteroid during development of the central nervous system.

Catalytic activity

3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate.

Subcellular location

Cytoplasm By similarity. Microsome By similarity.

Tissue specificity

Expressed at high levels in epididymis, intestine and uterus, and low levels in brain and hypothalamus. Isoform 2 is most prominent in the brain and spinal cord, with modest expression in the lung, skin and spleen. Isoform 1 is most prominently expressed in skin and small intestine, with modest expression in muscle and prostate. Ref.1 Ref.2

Developmental stage

Isoform 1 and isoform 2 are expressed from stages E8.5-E19 embryo. Ref.2

Sequence similarities

Belongs to the sulfotransferase 1 family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O35400-1)

Also known as: SULT2B1b; B;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O35400-2)

Also known as: SULT2B1a; A;

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDGPQPRALWSSSEKNVSEM → MTSRDCCCGGVEVDLLLRWTHGAQRKDTPHWRVNEGPCDSCPPPWSSLHVPFPSF
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 338338Sulfotransferase family cytosolic 2B member 1
PRO_0000085150

Regions

Nucleotide binding67 – 726PAPS By similarity
Nucleotide binding241 – 2466PAPS By similarity
Nucleotide binding271 – 2733PAPS By similarity

Sites

Active site1221Proton acceptor By similarity
Binding site951Substrate By similarity
Binding site1001Substrate By similarity
Binding site1441PAPS By similarity
Binding site1521PAPS By similarity
Binding site2071PAPS By similarity

Natural variations

Alternative sequence1 – 2020MDGPQ…NVSEM → MTSRDCCCGGVEVDLLLRWT HGAQRKDTPHWRVNEGPCDS CPPPWSSLHVPFPSF in isoform 2.
VSP_012511

Experimental info

Sequence conflict3291S → F in AAC69918. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (SULT2B1b) (B) [UniParc].

Last modified January 4, 2005. Version 2.
Checksum: EA21BAB0917034C1

FASTA33838,347
        10         20         30         40         50         60 
MDGPQPRALW SSSEKNVSEM SWNFGGEYFR YKGIPFPVGM YSPESLSLAE NTSNVRDDDI 

        70         80         90        100        110        120 
FIVTYPKSGT NWMIEIVCLI LKDGDPSWIR SEPIWQRAPW CETIISAFNV LDRPSPRIMS 

       130        140        150        160        170        180 
SHLPIELFTK AFFSSKAKVI YVGRNPRDVV VSLYYYSKIA GQLKDPGTPD QFLQNFLKGE 

       190        200        210        220        230        240 
VQFGSWFDHI KGWIRMQNQE NFLFITYEEL QQDLRGSVQR ICEFLGRPLG EEALSSVVAH 

       250        260        270        280        290        300 
SAFAAMKANT MSNYSLLPAS LLDHRQGEFL RKGISGDWKN HFTVAQSEAF DSVYREQMHG 

       310        320        330 
VQRFPWDTSE EDSSPDGQPD PEPSPSPASD DPNPGSSQ 

« Hide

Isoform 2 (SULT2B1a) (A) [UniParc].

Checksum: 8C4B1076532EFD4C
Show »

FASTA37342,308

References

« Hide 'large scale' references
[1]"Molecular cloning, expression, and functional characterization of novel mouse sulfotransferases."
Sakakibara Y., Yanagisawa K., Takami Y., Nakayama T., Suiko M., Liu M.-C.
Biochem. Biophys. Res. Commun. 247:681-686(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[2]"Conservation of the hydroxysteroid sulfotransferase SULT2B1 gene structure in the mouse: pre- and postnatal expression, kinetic analysis of isoforms, and comparison with prototypical SULT2A1."
Shimizu C., Fuda H., Yanai H., Strott C.A.
Endocrinology 144:1186-1193(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
Strain: C57BL/6.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6J, Czech II and FVB/N.
Tissue: Mammary gland.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF026072 mRNA. Translation: AAC69918.1.
AF478566 mRNA. Translation: AAM46788.1.
BC009811 mRNA. Translation: AAH09811.1.
BC009813 mRNA. Translation: AAH09813.1.
PIRJE0196.
RefSeqNP_059493.2. NM_017465.2.
UniGeneMm.271634.

3D structure databases

ProteinModelPortalO35400.
SMRO35400. Positions 26-307.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActO35400. 7 interactions.

PTM databases

PhosphoSiteO35400.

Proteomic databases

PaxDbO35400.
PRIDEO35400.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000075571; ENSMUSP00000075005; ENSMUSG00000003271. [O35400-1]
GeneID54200.
KEGGmmu:54200.
UCSCuc009gxb.2. mouse. [O35400-1]

Organism-specific databases

CTD6820.
MGIMGI:1926342. Sult2b1.

Phylogenomic databases

eggNOGNOG296990.
GeneTreeENSGT00670000097842.
HOGENOMHOG000037209.
HOVERGENHBG001195.
KOK01015.
OrthoDBEOG7V49ZK.
PhylomeDBO35400.
TreeFamTF321745.

Enzyme and pathway databases

BRENDA2.8.2.2. 3474.

Gene expression databases

ArrayExpressO35400.
BgeeO35400.
CleanExMM_SULT2B1.
GenevestigatorO35400.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 1 hit.
ProtoNetSearch...

Other

NextBio311058.
PROO35400.
SOURCESearch...

Entry information

Entry nameST2B1_MOUSE
AccessionPrimary (citable) accession number: O35400
Secondary accession number(s): Q8K472, Q91V03
Entry history
Integrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: January 4, 2005
Last modified: April 16, 2014
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot