Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interferon-activable protein 203

Gene

Ifi203

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

  • cellular response to interferon-beta Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Interferon-activable protein 203
Short name:
Ifi-203
Alternative name(s):
Interferon-inducible protein p203
Gene namesi
Name:Ifi203
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:96428. Ifi203.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001537201 – 408Interferon-activable protein 203Add BLAST408

Proteomic databases

EPDiO35368.
MaxQBiO35368.
PRIDEiO35368.

PTM databases

iPTMnetiO35368.
PhosphoSitePlusiO35368.

Expressioni

Tissue specificityi

Constitutively expressed in the thymus, bone marrow and spleen. Isoform 1 and isoform 3 are present in liver (at protein level).1 Publication

Inductioni

Isoform 1 and isoform 3 are induced by alpha interferon (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000039997.
CleanExiMM_IFI203.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

IntActiO35368. 2 interactors.
MINTiMINT-4121123.

Structurei

3D structure databases

ProteinModelPortaliO35368.
SMRiO35368.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 87PyrinPROSITE-ProRule annotationAdd BLAST87
Domaini190 – 388HIN-200PROSITE-ProRule annotationAdd BLAST199

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi141 – 144Poly-Lys4
Compositional biasi178 – 182Poly-Ser5

Sequence similaritiesi

Belongs to the HIN-200 family.Curated
Contains 1 HIN-200 domain.PROSITE-ProRule annotation
Contains 1 pyrin domain.PROSITE-ProRule annotation

Phylogenomic databases

HOVERGENiHBG006122.
InParanoidiO35368.
PhylomeDBiO35368.

Family and domain databases

InterProiIPR004020. DAPIN.
IPR011029. DEATH-like_dom.
IPR004021. HIN200/IF120x.
[Graphical view]
PfamiPF02760. HIN. 1 hit.
PF02758. PYRIN. 1 hit.
[Graphical view]
SMARTiSM01289. PYRIN. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
PROSITEiPS50824. DAPIN. 1 hit.
PS50834. HIN_200. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O35368-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEYKNIVLL KGLENMEDYQ FRTVKSLLRK ELKLTKKMQE DYDRIQLADW
60 70 80 90 100
MEDKFPKDAG LDKLIKVCEH IKDLKDLAKK LKTEKAKVQE KKKGKCKTAG
110 120 130 140 150
KKKGQDELSS SESLFINKES YKSVPSSKKK RKQITKTEGG KKKKLTQEQA
160 170 180 190 200
QLPETSGTNI KKEEDCLQNP HKSPPTPSSS SSNKAPRRGT VPKEPSREEG
210 220 230 240 250
HHQGPKQVMV LKVTEPFTYD FEETKRMFHA TVATETEFFR VKVFDTALMS
260 270 280 290 300
KFIPGKIIAI SHYIGCNGFL EIYRASCVSD VNINPTMIIS NTLSESAIAT
310 320 330 340 350
PKISYLLSQA KGTFVNGEFV VFKKSERHEC ICYGIGDDTG KMAVVVYGRL
360 370 380 390 400
TNVRCEPGSK LRLVCFELTS TKDVCLLRSV RHSYMQVINE GKPLNPDSVR

RNSLEPYF
Length:408
Mass (Da):46,300
Last modified:January 1, 1998 - v1
Checksum:i3BA0E01834D9E5A9
GO
Isoform 2 (identifier: O35368-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-191: APRRGTV → VTLSYPQ
     192-408: Missing.

Note: No experimental confirmation available.
Show »
Length:191
Mass (Da):21,865
Checksum:i115098D54CD688BE
GO
Isoform 3 (identifier: O35368-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-183: N → NKKNPVVASFLLASRASTSGAKTREQDILRHKQRPSRKGGFKTTFCERI

Show »
Length:456
Mass (Da):51,685
Checksum:iFBC5ED3B4912771C
GO

Sequence cautioni

The sequence BAE25996 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti51M → I in BAE25996 (PubMed:16141072).Curated1
Sequence conflicti51M → I in BAC30542 (PubMed:16141072).Curated1
Sequence conflicti90E → K in BAE25996 (PubMed:16141072).Curated1
Sequence conflicti90E → K in BAC30542 (PubMed:16141072).Curated1
Sequence conflicti93K → E in BAE25996 (PubMed:16141072).Curated1
Sequence conflicti93K → E in BAC30542 (PubMed:16141072).Curated1
Sequence conflicti98T → M in BAE41346 (PubMed:16141072).Curated1
Sequence conflicti116I → N in BAE25996 (PubMed:16141072).Curated1
Sequence conflicti116I → N in BAC30542 (PubMed:16141072).Curated1
Sequence conflicti121Y → N in BAE25996 (PubMed:16141072).Curated1
Sequence conflicti121Y → N in BAC30542 (PubMed:16141072).Curated1
Isoform 3 (identifier: O35368-3)
Sequence conflicti197R → Q in AAH08167 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_033652183N → NKKNPVVASFLLASRASTSG AKTREQDILRHKQRPSRKGG FKTTFCERI in isoform 3. 2 Publications1
Alternative sequenceiVSP_033653185 – 191APRRGTV → VTLSYPQ in isoform 2. 1 Publication7
Alternative sequenceiVSP_033654192 – 408Missing in isoform 2. 1 PublicationAdd BLAST217

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF022371 mRNA. Translation: AAC53428.1.
AK040214 mRNA. Translation: BAC30542.1.
AK144663 mRNA. Translation: BAE25996.1. Different initiation.
AK164695 mRNA. Translation: BAE37880.1.
AK169754 mRNA. Translation: BAE41346.1.
AK172505 mRNA. Translation: BAE43039.1.
BC008167 mRNA. Translation: AAH08167.1.
RefSeqiNP_001289578.1. NM_001302649.1.
NP_001289579.1. NM_001302650.1.
NP_001289580.1. NM_001302651.1.
UniGeneiMm.463437.
Mm.472787.

Genome annotation databases

GeneIDi15950.
KEGGimmu:15950.
UCSCiuc007dsj.1. mouse. [O35368-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF022371 mRNA. Translation: AAC53428.1.
AK040214 mRNA. Translation: BAC30542.1.
AK144663 mRNA. Translation: BAE25996.1. Different initiation.
AK164695 mRNA. Translation: BAE37880.1.
AK169754 mRNA. Translation: BAE41346.1.
AK172505 mRNA. Translation: BAE43039.1.
BC008167 mRNA. Translation: AAH08167.1.
RefSeqiNP_001289578.1. NM_001302649.1.
NP_001289579.1. NM_001302650.1.
NP_001289580.1. NM_001302651.1.
UniGeneiMm.463437.
Mm.472787.

3D structure databases

ProteinModelPortaliO35368.
SMRiO35368.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO35368. 2 interactors.
MINTiMINT-4121123.

PTM databases

iPTMnetiO35368.
PhosphoSitePlusiO35368.

Proteomic databases

EPDiO35368.
MaxQBiO35368.
PRIDEiO35368.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi15950.
KEGGimmu:15950.
UCSCiuc007dsj.1. mouse. [O35368-2]

Organism-specific databases

CTDi15950.
MGIiMGI:96428. Ifi203.

Phylogenomic databases

HOVERGENiHBG006122.
InParanoidiO35368.
PhylomeDBiO35368.

Miscellaneous databases

ChiTaRSiIfi203. mouse.
PROiO35368.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000039997.
CleanExiMM_IFI203.

Family and domain databases

InterProiIPR004020. DAPIN.
IPR011029. DEATH-like_dom.
IPR004021. HIN200/IF120x.
[Graphical view]
PfamiPF02760. HIN. 1 hit.
PF02758. PYRIN. 1 hit.
[Graphical view]
SMARTiSM01289. PYRIN. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
PROSITEiPS50824. DAPIN. 1 hit.
PS50834. HIN_200. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiIFI3_MOUSE
AccessioniPrimary (citable) accession number: O35368
Secondary accession number(s): Q3T9I1
, Q3TEA2, Q3TP57, Q3UMV2, Q8BYE5, Q91VV8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: January 1, 1998
Last modified: November 30, 2016
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.