Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O35136

- NCAM2_MOUSE

UniProt

O35136 - NCAM2_MOUSE

Protein

Neural cell adhesion molecule 2

Gene

Ncam2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 1 (01 Jan 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

    GO - Biological processi

    1. axonal fasciculation Source: Ensembl
    2. cell adhesion Source: UniProtKB-KW
    3. sensory perception of smell Source: Ensembl

    Keywords - Biological processi

    Cell adhesion

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neural cell adhesion molecule 2
    Short name:
    N-CAM-2
    Short name:
    NCAM-2
    Alternative name(s):
    Neural cell adhesion molecule RB-8
    R4B12
    Gene namesi
    Name:Ncam2
    Synonyms:Ocam, Rncam
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 16

    Organism-specific databases

    MGIiMGI:97282. Ncam2.

    Subcellular locationi

    GO - Cellular componenti

    1. anchored component of membrane Source: UniProtKB-KW
    2. axon Source: MGI
    3. integral component of membrane Source: UniProtKB-KW
    4. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1919Sequence AnalysisAdd
    BLAST
    Chaini20 – 837818Neural cell adhesion molecule 2PRO_0000042589Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi42 ↔ 93Curated
    Disulfide bondi136 ↔ 186Curated
    Glycosylationi177 – 1771N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi219 – 2191N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi232 ↔ 281Curated
    Glycosylationi309 – 3091N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi322 ↔ 380Curated
    Glycosylationi406 – 4061N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi419 – 4191N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi422 ↔ 475Curated
    Glycosylationi445 – 4451N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi474 – 4741N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi562 – 5621N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    The GPI-anchor may be located on 'Asn-703' of isoform Short.

    Keywords - PTMi

    Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

    Proteomic databases

    MaxQBiO35136.
    PaxDbiO35136.
    PRIDEiO35136.

    PTM databases

    PhosphoSiteiO35136.

    Expressioni

    Tissue specificityi

    Expressed in subsets of both olfactory and vomeronasal neurons in a zone-specific manner.

    Gene expression databases

    BgeeiO35136.
    CleanExiMM_NCAM2.
    GenevestigatoriO35136.

    Interactioni

    Protein-protein interaction databases

    BioGridi201700. 1 interaction.
    IntActiO35136. 2 interactions.
    MINTiMINT-1177341.

    Structurei

    3D structure databases

    ProteinModelPortaliO35136.
    SMRiO35136. Positions 19-693.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini20 – 697678ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini719 – 837119CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei698 – 71821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini21 – 10888Ig-like C2-type 1Add
    BLAST
    Domaini113 – 20290Ig-like C2-type 2Add
    BLAST
    Domaini208 – 29790Ig-like C2-type 3Add
    BLAST
    Domaini302 – 39695Ig-like C2-type 4Add
    BLAST
    Domaini401 – 49191Ig-like C2-type 5Add
    BLAST
    Domaini495 – 59197Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini593 – 68896Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG308439.
    GeneTreeiENSGT00750000117404.
    HOGENOMiHOG000074124.
    HOVERGENiHBG052579.
    InParanoidiO35136.
    KOiK06491.
    OMAiEPTISWY.
    OrthoDBiEOG75MVVH.
    PhylomeDBiO35136.
    TreeFamiTF326195.

    Family and domain databases

    Gene3Di2.60.40.10. 7 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    IPR009138. Neural_cell_adh.
    [Graphical view]
    PfamiPF00041. fn3. 2 hits.
    PF07679. I-set. 5 hits.
    [Graphical view]
    PRINTSiPR01838. NCAMFAMILY.
    SMARTiSM00060. FN3. 2 hits.
    SM00408. IGc2. 5 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 1 hit.
    PROSITEiPS50853. FN3. 2 hits.
    PS50835. IG_LIKE. 5 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform Long (identifier: O35136-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSLLLSFYLL GLLVRSGQAL LQVTISLSKV ELSVGESKFF TCTAIGEPES    50
    IDWYNPQGEK IISTQRVMLQ KEGVRSRLTI YNANIEDAGI YRCQATDAKG 100
    QTQEATVVLE IYQKLTFREV VSPQEFKQGE DAEVVCRVSS SPAPAVSWLY 150
    HNEEVTTIPD NRFAVLANNN LQILNINKSD EGIYRCEGRV EARGEIDFRD 200
    IIVIVNVPPA IMMPQKSFNA TAERGEEMTL TCKASGSPDP TISWFRNGKL 250
    IEENEKYILK GSNTELTVRN IINKDGGSYV CKATNKAGED QKQAFLQVFV 300
    QPHILQLKNE TTSENGHVTL VCEAEGEPVP EITWKRAIDG VMFSEGDKSP 350
    DGRIEVKGQH GRSSLHIRDV KLSDSGRYDC EAASRIGGHQ RSMHLDIEYA 400
    PKFVSNQTMY YSWEGNPINI SCDVTANPPA SIHWRREKLL LPAKNTTHLK 450
    THSVGRKMIL EIAPTSDNDF GRYNCTATNR IGTRFQEYIL ELADVPSSPH 500
    GVKIIELSQT TAKISFNKPE SHGGVPIHHY QVDVKEVASE TWKIVRSHGV 550
    QTMVVLSSLE PNTTYEIRVA AVNGKGQGDY SKIEIFQTLP VREPSPPSIH 600
    GQPSSGKSFK ISITKQDDGG APILEYIVKY RSKDKEDQWL EKKVQGNKDH 650
    IILEHLQWTM GYEVQITAAN RLGYSEPTVY EFSMPPKPNI IKDTLFNGLG 700
    LGAIIGLGVA ALLLILVVTD VSCFFIRQCG LLMCITRRMC GKKSGSSGKS 750
    KELEEGKAAY LKDGSKEPIV EMRTEDERIT NHEDGSPVNE PNETTPLTEP 800
    EKLPLKEENG KEVLNAETIE IKVSNDIIQS KEDDIKA 837
    Length:837
    Mass (Da):93,204
    Last modified:January 1, 1998 - v1
    Checksum:i70473B053A2D65A5
    GO
    Isoform Short (identifier: O35136-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         694-837: TLFNGLGLGA...IQSKEDDIKA → NCCEANKGENGGQSWHLNAVGFTFVITMSLSCLF

    Note: GPI-anchor amidated asparagine on Asn-703.Curated

    Show »
    Length:727
    Mass (Da):81,208
    Checksum:iBAE4590B330516C8
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei694 – 837144TLFNG…DDIKA → NCCEANKGENGGQSWHLNAV GFTFVITMSLSCLF in isoform Short. 3 PublicationsVSP_002590Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF001287 mRNA. Translation: AAB69125.1.
    AF001286 mRNA. Translation: AAB69124.1.
    AF016619 mRNA. Translation: AAC53375.1.
    BC119027 mRNA. Translation: AAI19028.1.
    BC119029 mRNA. Translation: AAI19030.1.
    CCDSiCCDS28281.1. [O35136-2]
    CCDS49888.1. [O35136-1]
    RefSeqiNP_001106679.1. NM_001113208.1. [O35136-1]
    NP_035084.1. NM_010954.4. [O35136-2]
    UniGeneiMm.433941.

    Genome annotation databases

    EnsembliENSMUST00000037785; ENSMUSP00000049390; ENSMUSG00000022762. [O35136-2]
    ENSMUST00000067602; ENSMUSP00000063468; ENSMUSG00000022762. [O35136-1]
    GeneIDi17968.
    KEGGimmu:17968.
    UCSCiuc007zta.2. mouse. [O35136-2]
    uc007ztb.2. mouse. [O35136-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF001287 mRNA. Translation: AAB69125.1 .
    AF001286 mRNA. Translation: AAB69124.1 .
    AF016619 mRNA. Translation: AAC53375.1 .
    BC119027 mRNA. Translation: AAI19028.1 .
    BC119029 mRNA. Translation: AAI19030.1 .
    CCDSi CCDS28281.1. [O35136-2 ]
    CCDS49888.1. [O35136-1 ]
    RefSeqi NP_001106679.1. NM_001113208.1. [O35136-1 ]
    NP_035084.1. NM_010954.4. [O35136-2 ]
    UniGenei Mm.433941.

    3D structure databases

    ProteinModelPortali O35136.
    SMRi O35136. Positions 19-693.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 201700. 1 interaction.
    IntActi O35136. 2 interactions.
    MINTi MINT-1177341.

    PTM databases

    PhosphoSitei O35136.

    Proteomic databases

    MaxQBi O35136.
    PaxDbi O35136.
    PRIDEi O35136.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000037785 ; ENSMUSP00000049390 ; ENSMUSG00000022762 . [O35136-2 ]
    ENSMUST00000067602 ; ENSMUSP00000063468 ; ENSMUSG00000022762 . [O35136-1 ]
    GeneIDi 17968.
    KEGGi mmu:17968.
    UCSCi uc007zta.2. mouse. [O35136-2 ]
    uc007ztb.2. mouse. [O35136-1 ]

    Organism-specific databases

    CTDi 4685.
    MGIi MGI:97282. Ncam2.

    Phylogenomic databases

    eggNOGi NOG308439.
    GeneTreei ENSGT00750000117404.
    HOGENOMi HOG000074124.
    HOVERGENi HBG052579.
    InParanoidi O35136.
    KOi K06491.
    OMAi EPTISWY.
    OrthoDBi EOG75MVVH.
    PhylomeDBi O35136.
    TreeFami TF326195.

    Miscellaneous databases

    NextBioi 292909.
    PROi O35136.
    SOURCEi Search...

    Gene expression databases

    Bgeei O35136.
    CleanExi MM_NCAM2.
    Genevestigatori O35136.

    Family and domain databases

    Gene3Di 2.60.40.10. 7 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    IPR009138. Neural_cell_adh.
    [Graphical view ]
    Pfami PF00041. fn3. 2 hits.
    PF07679. I-set. 5 hits.
    [Graphical view ]
    PRINTSi PR01838. NCAMFAMILY.
    SMARTi SM00060. FN3. 2 hits.
    SM00408. IGc2. 5 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 1 hit.
    PROSITEi PS50853. FN3. 2 hits.
    PS50835. IG_LIKE. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "OCAM: a new member of the neural cell adhesion molecule family related to zone-to-zone projection of olfactory and vomeronasal axons."
      Yoshihara Y., Kawasaki M., Tamada A., Fujita H., Hayashi H., Kagamiyama H., Mori K.
      J. Neurosci. 17:5830-5842(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT).
      Strain: BALB/c.
      Tissue: Olfactory neuroepithelium.
    2. "Identification of a novel neural cell adhesion molecule-related gene with a potential role in selective axonal projection."
      Alenius M., Bohm S.
      J. Biol. Chem. 272:26083-26086(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
      Strain: C57BL/6J.
      Tissue: Olfactory epithelium.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
      Tissue: Brain.

    Entry informationi

    Entry nameiNCAM2_MOUSE
    AccessioniPrimary (citable) accession number: O35136
    Secondary accession number(s): O35962, Q0VF23
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: January 1, 1998
    Last modified: October 1, 2014
    This is version 129 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3