Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O35136 (NCAM2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Neural cell adhesion molecule 2

Short name=N-CAM-2
Short name=NCAM-2
Alternative name(s):
Neural cell adhesion molecule RB-8
R4B12
Gene names
Name:Ncam2
Synonyms:Ocam, Rncam
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length837 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

Subcellular location

Isoform Long: Cell membrane; Single-pass type I membrane protein.

Isoform Short: Cell membrane; Lipid-anchorGPI-anchor.

Tissue specificity

Expressed in subsets of both olfactory and vomeronasal neurons in a zone-specific manner.

Post-translational modification

The GPI-anchor may be located on 'Asn-703' of isoform Short.

Sequence similarities

Contains 2 fibronectin type-III domains.

Contains 5 Ig-like C2-type (immunoglobulin-like) domains.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform Long (identifier: O35136-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Short (identifier: O35136-2)

The sequence of this isoform differs from the canonical sequence as follows:
     694-837: TLFNGLGLGA...IQSKEDDIKA → NCCEANKGENGGQSWHLNAVGFTFVITMSLSCLF
Note: GPI-anchor amidated asparagine on Asn-703 (Potential).

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1919 Potential
Chain20 – 837818Neural cell adhesion molecule 2
PRO_0000042589

Regions

Topological domain20 – 697678Extracellular Potential
Transmembrane698 – 71821Helical; Potential
Topological domain719 – 837119Cytoplasmic Potential
Domain21 – 10888Ig-like C2-type 1
Domain113 – 20290Ig-like C2-type 2
Domain208 – 29790Ig-like C2-type 3
Domain302 – 39695Ig-like C2-type 4
Domain401 – 49191Ig-like C2-type 5
Domain495 – 59197Fibronectin type-III 1
Domain593 – 68896Fibronectin type-III 2

Amino acid modifications

Glycosylation1771N-linked (GlcNAc...) Potential
Glycosylation2191N-linked (GlcNAc...) Potential
Glycosylation3091N-linked (GlcNAc...) Potential
Glycosylation4061N-linked (GlcNAc...) Potential
Glycosylation4191N-linked (GlcNAc...) Potential
Glycosylation4451N-linked (GlcNAc...) Potential
Glycosylation4741N-linked (GlcNAc...) Potential
Glycosylation5621N-linked (GlcNAc...) Potential
Disulfide bond42 ↔ 93 Probable
Disulfide bond136 ↔ 186 Probable
Disulfide bond232 ↔ 281 Probable
Disulfide bond322 ↔ 380 Probable
Disulfide bond422 ↔ 475 Probable

Natural variations

Alternative sequence694 – 837144TLFNG…DDIKA → NCCEANKGENGGQSWHLNAV GFTFVITMSLSCLF in isoform Short.
VSP_002590

Sequences

Sequence LengthMass (Da)Tools
Isoform Long [UniParc].

Last modified January 1, 1998. Version 1.
Checksum: 70473B053A2D65A5

FASTA83793,204
        10         20         30         40         50         60 
MSLLLSFYLL GLLVRSGQAL LQVTISLSKV ELSVGESKFF TCTAIGEPES IDWYNPQGEK 

        70         80         90        100        110        120 
IISTQRVMLQ KEGVRSRLTI YNANIEDAGI YRCQATDAKG QTQEATVVLE IYQKLTFREV 

       130        140        150        160        170        180 
VSPQEFKQGE DAEVVCRVSS SPAPAVSWLY HNEEVTTIPD NRFAVLANNN LQILNINKSD 

       190        200        210        220        230        240 
EGIYRCEGRV EARGEIDFRD IIVIVNVPPA IMMPQKSFNA TAERGEEMTL TCKASGSPDP 

       250        260        270        280        290        300 
TISWFRNGKL IEENEKYILK GSNTELTVRN IINKDGGSYV CKATNKAGED QKQAFLQVFV 

       310        320        330        340        350        360 
QPHILQLKNE TTSENGHVTL VCEAEGEPVP EITWKRAIDG VMFSEGDKSP DGRIEVKGQH 

       370        380        390        400        410        420 
GRSSLHIRDV KLSDSGRYDC EAASRIGGHQ RSMHLDIEYA PKFVSNQTMY YSWEGNPINI 

       430        440        450        460        470        480 
SCDVTANPPA SIHWRREKLL LPAKNTTHLK THSVGRKMIL EIAPTSDNDF GRYNCTATNR 

       490        500        510        520        530        540 
IGTRFQEYIL ELADVPSSPH GVKIIELSQT TAKISFNKPE SHGGVPIHHY QVDVKEVASE 

       550        560        570        580        590        600 
TWKIVRSHGV QTMVVLSSLE PNTTYEIRVA AVNGKGQGDY SKIEIFQTLP VREPSPPSIH 

       610        620        630        640        650        660 
GQPSSGKSFK ISITKQDDGG APILEYIVKY RSKDKEDQWL EKKVQGNKDH IILEHLQWTM 

       670        680        690        700        710        720 
GYEVQITAAN RLGYSEPTVY EFSMPPKPNI IKDTLFNGLG LGAIIGLGVA ALLLILVVTD 

       730        740        750        760        770        780 
VSCFFIRQCG LLMCITRRMC GKKSGSSGKS KELEEGKAAY LKDGSKEPIV EMRTEDERIT 

       790        800        810        820        830 
NHEDGSPVNE PNETTPLTEP EKLPLKEENG KEVLNAETIE IKVSNDIIQS KEDDIKA 

« Hide

Isoform Short [UniParc].

Checksum: BAE4590B330516C8
Show »

FASTA72781,208

References

« Hide 'large scale' references
[1]"OCAM: a new member of the neural cell adhesion molecule family related to zone-to-zone projection of olfactory and vomeronasal axons."
Yoshihara Y., Kawasaki M., Tamada A., Fujita H., Hayashi H., Kagamiyama H., Mori K.
J. Neurosci. 17:5830-5842(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT).
Strain: BALB/c.
Tissue: Olfactory neuroepithelium.
[2]"Identification of a novel neural cell adhesion molecule-related gene with a potential role in selective axonal projection."
Alenius M., Bohm S.
J. Biol. Chem. 272:26083-26086(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
Strain: C57BL/6J.
Tissue: Olfactory epithelium.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF001287 mRNA. Translation: AAB69125.1.
AF001286 mRNA. Translation: AAB69124.1.
AF016619 mRNA. Translation: AAC53375.1.
BC119027 mRNA. Translation: AAI19028.1.
BC119029 mRNA. Translation: AAI19030.1.
CCDSCCDS28281.1. [O35136-2]
CCDS49888.1. [O35136-1]
RefSeqNP_001106679.1. NM_001113208.1. [O35136-1]
NP_035084.1. NM_010954.4. [O35136-2]
UniGeneMm.433941.

3D structure databases

ProteinModelPortalO35136.
SMRO35136. Positions 19-693.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid201700. 1 interaction.
IntActO35136. 2 interactions.
MINTMINT-1177341.

PTM databases

PhosphoSiteO35136.

Proteomic databases

MaxQBO35136.
PaxDbO35136.
PRIDEO35136.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000037785; ENSMUSP00000049390; ENSMUSG00000022762. [O35136-2]
ENSMUST00000067602; ENSMUSP00000063468; ENSMUSG00000022762. [O35136-1]
GeneID17968.
KEGGmmu:17968.
UCSCuc007zta.2. mouse. [O35136-2]
uc007ztb.2. mouse. [O35136-1]

Organism-specific databases

CTD4685.
MGIMGI:97282. Ncam2.

Phylogenomic databases

eggNOGNOG308439.
GeneTreeENSGT00750000117404.
HOGENOMHOG000074124.
HOVERGENHBG052579.
InParanoidO35136.
KOK06491.
OMAEPTISWY.
OrthoDBEOG75MVVH.
PhylomeDBO35136.
TreeFamTF326195.

Gene expression databases

BgeeO35136.
CleanExMM_NCAM2.
GenevestigatorO35136.

Family and domain databases

Gene3D2.60.40.10. 7 hits.
InterProIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR009138. Neural_cell_adh.
[Graphical view]
PfamPF00041. fn3. 2 hits.
PF07679. I-set. 5 hits.
[Graphical view]
PRINTSPR01838. NCAMFAMILY.
SMARTSM00060. FN3. 2 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMSSF49265. SSF49265. 1 hit.
PROSITEPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio292909.
PROO35136.
SOURCESearch...

Entry information

Entry nameNCAM2_MOUSE
AccessionPrimary (citable) accession number: O35136
Secondary accession number(s): O35962, Q0VF23
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 1, 1998
Last modified: July 9, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot