Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neural cell adhesion molecule 2

Gene

Ncam2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Neural cell adhesion molecule 2
Short name:
N-CAM-2
Short name:
NCAM-2
Alternative name(s):
Neural cell adhesion molecule RB-8
R4B12
Gene namesi
Name:Ncam2
Synonyms:Ocam, Rncam
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:97282. Ncam2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 697ExtracellularSequence analysisAdd BLAST678
Transmembranei698 – 718HelicalSequence analysisAdd BLAST21
Topological domaini719 – 837CytoplasmicSequence analysisAdd BLAST119

GO - Cellular componenti

  • anchored component of membrane Source: UniProtKB-KW
  • axon Source: MGI
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000004258920 – 837Neural cell adhesion molecule 2Add BLAST818

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi42 ↔ 93Curated
Disulfide bondi136 ↔ 186Curated
Glycosylationi177N-linked (GlcNAc...)Sequence analysis1
Glycosylationi219N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi232 ↔ 281Curated
Glycosylationi309N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi322 ↔ 380Curated
Glycosylationi406N-linked (GlcNAc...)Sequence analysis1
Glycosylationi419N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi422 ↔ 475Curated
Glycosylationi445N-linked (GlcNAc...)Sequence analysis1
Glycosylationi474N-linked (GlcNAc...)Sequence analysis1
Glycosylationi562N-linked (GlcNAc...)Sequence analysis1
Modified residuei765PhosphoserineCombined sources1
Modified residuei780PhosphothreonineCombined sources1
Modified residuei786PhosphoserineCombined sources1

Post-translational modificationi

The GPI-anchor may be located on 'Asn-703' of isoform Short.

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein, Phosphoprotein

Proteomic databases

MaxQBiO35136.
PaxDbiO35136.
PeptideAtlasiO35136.
PRIDEiO35136.

PTM databases

iPTMnetiO35136.
PhosphoSitePlusiO35136.
SwissPalmiO35136.

Expressioni

Tissue specificityi

Expressed in subsets of both olfactory and vomeronasal neurons in a zone-specific manner.

Gene expression databases

BgeeiENSMUSG00000022762.
CleanExiMM_NCAM2.
GenevisibleiO35136. MM.

Interactioni

Protein-protein interaction databases

BioGridi201700. 1 interactor.
IntActiO35136. 2 interactors.
MINTiMINT-1177341.
STRINGi10090.ENSMUSP00000063468.

Structurei

3D structure databases

ProteinModelPortaliO35136.
SMRiO35136.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini21 – 108Ig-like C2-type 1Add BLAST88
Domaini113 – 202Ig-like C2-type 2Add BLAST90
Domaini208 – 297Ig-like C2-type 3Add BLAST90
Domaini302 – 396Ig-like C2-type 4Add BLAST95
Domaini401 – 491Ig-like C2-type 5Add BLAST91
Domaini495 – 591Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST97
Domaini593 – 688Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST96

Sequence similaritiesi

Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IQJD. Eukaryota.
ENOG41118FG. LUCA.
GeneTreeiENSGT00860000133697.
HOGENOMiHOG000074124.
HOVERGENiHBG052579.
InParanoidiO35136.
KOiK06491.
OMAiNISCDVM.
OrthoDBiEOG091G00V0.
PhylomeDBiO35136.
TreeFamiTF326195.

Family and domain databases

CDDicd00063. FN3. 2 hits.
Gene3Di2.60.40.10. 7 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR009138. Neural_cell_adh.
[Graphical view]
PfamiPF00041. fn3. 2 hits.
PF07679. I-set. 4 hits.
[Graphical view]
PRINTSiPR01838. NCAMFAMILY.
SMARTiSM00060. FN3. 2 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
SM00406. IGv. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
SSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: O35136-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLLLSFYLL GLLVRSGQAL LQVTISLSKV ELSVGESKFF TCTAIGEPES
60 70 80 90 100
IDWYNPQGEK IISTQRVMLQ KEGVRSRLTI YNANIEDAGI YRCQATDAKG
110 120 130 140 150
QTQEATVVLE IYQKLTFREV VSPQEFKQGE DAEVVCRVSS SPAPAVSWLY
160 170 180 190 200
HNEEVTTIPD NRFAVLANNN LQILNINKSD EGIYRCEGRV EARGEIDFRD
210 220 230 240 250
IIVIVNVPPA IMMPQKSFNA TAERGEEMTL TCKASGSPDP TISWFRNGKL
260 270 280 290 300
IEENEKYILK GSNTELTVRN IINKDGGSYV CKATNKAGED QKQAFLQVFV
310 320 330 340 350
QPHILQLKNE TTSENGHVTL VCEAEGEPVP EITWKRAIDG VMFSEGDKSP
360 370 380 390 400
DGRIEVKGQH GRSSLHIRDV KLSDSGRYDC EAASRIGGHQ RSMHLDIEYA
410 420 430 440 450
PKFVSNQTMY YSWEGNPINI SCDVTANPPA SIHWRREKLL LPAKNTTHLK
460 470 480 490 500
THSVGRKMIL EIAPTSDNDF GRYNCTATNR IGTRFQEYIL ELADVPSSPH
510 520 530 540 550
GVKIIELSQT TAKISFNKPE SHGGVPIHHY QVDVKEVASE TWKIVRSHGV
560 570 580 590 600
QTMVVLSSLE PNTTYEIRVA AVNGKGQGDY SKIEIFQTLP VREPSPPSIH
610 620 630 640 650
GQPSSGKSFK ISITKQDDGG APILEYIVKY RSKDKEDQWL EKKVQGNKDH
660 670 680 690 700
IILEHLQWTM GYEVQITAAN RLGYSEPTVY EFSMPPKPNI IKDTLFNGLG
710 720 730 740 750
LGAIIGLGVA ALLLILVVTD VSCFFIRQCG LLMCITRRMC GKKSGSSGKS
760 770 780 790 800
KELEEGKAAY LKDGSKEPIV EMRTEDERIT NHEDGSPVNE PNETTPLTEP
810 820 830
EKLPLKEENG KEVLNAETIE IKVSNDIIQS KEDDIKA
Length:837
Mass (Da):93,204
Last modified:January 1, 1998 - v1
Checksum:i70473B053A2D65A5
GO
Isoform Short (identifier: O35136-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     694-837: TLFNGLGLGA...IQSKEDDIKA → NCCEANKGENGGQSWHLNAVGFTFVITMSLSCLF

Note: GPI-anchor amidated asparagine on Asn-703.Curated
Show »
Length:727
Mass (Da):81,208
Checksum:iBAE4590B330516C8
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002590694 – 837TLFNG…DDIKA → NCCEANKGENGGQSWHLNAV GFTFVITMSLSCLF in isoform Short. 3 PublicationsAdd BLAST144

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001287 mRNA. Translation: AAB69125.1.
AF001286 mRNA. Translation: AAB69124.1.
AF016619 mRNA. Translation: AAC53375.1.
BC119027 mRNA. Translation: AAI19028.1.
BC119029 mRNA. Translation: AAI19030.1.
CCDSiCCDS28281.1. [O35136-2]
CCDS49888.1. [O35136-1]
RefSeqiNP_001106679.1. NM_001113208.1. [O35136-1]
NP_035084.1. NM_010954.4. [O35136-2]
UniGeneiMm.433941.

Genome annotation databases

EnsembliENSMUST00000037785; ENSMUSP00000049390; ENSMUSG00000022762. [O35136-2]
ENSMUST00000067602; ENSMUSP00000063468; ENSMUSG00000022762. [O35136-1]
GeneIDi17968.
KEGGimmu:17968.
UCSCiuc007zta.2. mouse. [O35136-2]
uc007ztb.2. mouse. [O35136-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001287 mRNA. Translation: AAB69125.1.
AF001286 mRNA. Translation: AAB69124.1.
AF016619 mRNA. Translation: AAC53375.1.
BC119027 mRNA. Translation: AAI19028.1.
BC119029 mRNA. Translation: AAI19030.1.
CCDSiCCDS28281.1. [O35136-2]
CCDS49888.1. [O35136-1]
RefSeqiNP_001106679.1. NM_001113208.1. [O35136-1]
NP_035084.1. NM_010954.4. [O35136-2]
UniGeneiMm.433941.

3D structure databases

ProteinModelPortaliO35136.
SMRiO35136.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201700. 1 interactor.
IntActiO35136. 2 interactors.
MINTiMINT-1177341.
STRINGi10090.ENSMUSP00000063468.

PTM databases

iPTMnetiO35136.
PhosphoSitePlusiO35136.
SwissPalmiO35136.

Proteomic databases

MaxQBiO35136.
PaxDbiO35136.
PeptideAtlasiO35136.
PRIDEiO35136.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000037785; ENSMUSP00000049390; ENSMUSG00000022762. [O35136-2]
ENSMUST00000067602; ENSMUSP00000063468; ENSMUSG00000022762. [O35136-1]
GeneIDi17968.
KEGGimmu:17968.
UCSCiuc007zta.2. mouse. [O35136-2]
uc007ztb.2. mouse. [O35136-1]

Organism-specific databases

CTDi4685.
MGIiMGI:97282. Ncam2.

Phylogenomic databases

eggNOGiENOG410IQJD. Eukaryota.
ENOG41118FG. LUCA.
GeneTreeiENSGT00860000133697.
HOGENOMiHOG000074124.
HOVERGENiHBG052579.
InParanoidiO35136.
KOiK06491.
OMAiNISCDVM.
OrthoDBiEOG091G00V0.
PhylomeDBiO35136.
TreeFamiTF326195.

Miscellaneous databases

PROiO35136.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022762.
CleanExiMM_NCAM2.
GenevisibleiO35136. MM.

Family and domain databases

CDDicd00063. FN3. 2 hits.
Gene3Di2.60.40.10. 7 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR009138. Neural_cell_adh.
[Graphical view]
PfamiPF00041. fn3. 2 hits.
PF07679. I-set. 4 hits.
[Graphical view]
PRINTSiPR01838. NCAMFAMILY.
SMARTiSM00060. FN3. 2 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
SM00406. IGv. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
SSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNCAM2_MOUSE
AccessioniPrimary (citable) accession number: O35136
Secondary accession number(s): O35962, Q0VF23
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 1, 1998
Last modified: November 30, 2016
This is version 148 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.