Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O35136

- NCAM2_MOUSE

UniProt

O35136 - NCAM2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neural cell adhesion molecule 2

Gene

Ncam2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

GO - Biological processi

  1. axonal fasciculation Source: Ensembl
  2. cell adhesion Source: UniProtKB-KW
  3. sensory perception of smell Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Neural cell adhesion molecule 2
Short name:
N-CAM-2
Short name:
NCAM-2
Alternative name(s):
Neural cell adhesion molecule RB-8
R4B12
Gene namesi
Name:Ncam2
Synonyms:Ocam, Rncam
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 16

Organism-specific databases

MGIiMGI:97282. Ncam2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 697678ExtracellularSequence AnalysisAdd
BLAST
Transmembranei698 – 71821HelicalSequence AnalysisAdd
BLAST
Topological domaini719 – 837119CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. anchored component of membrane Source: UniProtKB-KW
  2. axon Source: MGI
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 837818Neural cell adhesion molecule 2PRO_0000042589Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi42 ↔ 93Curated
Disulfide bondi136 ↔ 186Curated
Glycosylationi177 – 1771N-linked (GlcNAc...)Sequence Analysis
Glycosylationi219 – 2191N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi232 ↔ 281Curated
Glycosylationi309 – 3091N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi322 ↔ 380Curated
Glycosylationi406 – 4061N-linked (GlcNAc...)Sequence Analysis
Glycosylationi419 – 4191N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi422 ↔ 475Curated
Glycosylationi445 – 4451N-linked (GlcNAc...)Sequence Analysis
Glycosylationi474 – 4741N-linked (GlcNAc...)Sequence Analysis
Glycosylationi562 – 5621N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

The GPI-anchor may be located on 'Asn-703' of isoform Short.

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

MaxQBiO35136.
PaxDbiO35136.
PRIDEiO35136.

PTM databases

PhosphoSiteiO35136.

Expressioni

Tissue specificityi

Expressed in subsets of both olfactory and vomeronasal neurons in a zone-specific manner.

Gene expression databases

BgeeiO35136.
CleanExiMM_NCAM2.
ExpressionAtlasiO35136. baseline and differential.
GenevestigatoriO35136.

Interactioni

Protein-protein interaction databases

BioGridi201700. 1 interaction.
IntActiO35136. 2 interactions.
MINTiMINT-1177341.

Structurei

3D structure databases

ProteinModelPortaliO35136.
SMRiO35136. Positions 19-693.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini21 – 10888Ig-like C2-type 1Add
BLAST
Domaini113 – 20290Ig-like C2-type 2Add
BLAST
Domaini208 – 29790Ig-like C2-type 3Add
BLAST
Domaini302 – 39695Ig-like C2-type 4Add
BLAST
Domaini401 – 49191Ig-like C2-type 5Add
BLAST
Domaini495 – 59197Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini593 – 68896Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG308439.
GeneTreeiENSGT00770000120473.
HOGENOMiHOG000074124.
HOVERGENiHBG052579.
InParanoidiO35136.
KOiK06491.
OMAiEPTISWY.
OrthoDBiEOG75MVVH.
PhylomeDBiO35136.
TreeFamiTF326195.

Family and domain databases

Gene3Di2.60.40.10. 7 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR009138. Neural_cell_adh.
[Graphical view]
PfamiPF00041. fn3. 2 hits.
PF07679. I-set. 5 hits.
[Graphical view]
PRINTSiPR01838. NCAMFAMILY.
SMARTiSM00060. FN3. 2 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: O35136-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLLLSFYLL GLLVRSGQAL LQVTISLSKV ELSVGESKFF TCTAIGEPES
60 70 80 90 100
IDWYNPQGEK IISTQRVMLQ KEGVRSRLTI YNANIEDAGI YRCQATDAKG
110 120 130 140 150
QTQEATVVLE IYQKLTFREV VSPQEFKQGE DAEVVCRVSS SPAPAVSWLY
160 170 180 190 200
HNEEVTTIPD NRFAVLANNN LQILNINKSD EGIYRCEGRV EARGEIDFRD
210 220 230 240 250
IIVIVNVPPA IMMPQKSFNA TAERGEEMTL TCKASGSPDP TISWFRNGKL
260 270 280 290 300
IEENEKYILK GSNTELTVRN IINKDGGSYV CKATNKAGED QKQAFLQVFV
310 320 330 340 350
QPHILQLKNE TTSENGHVTL VCEAEGEPVP EITWKRAIDG VMFSEGDKSP
360 370 380 390 400
DGRIEVKGQH GRSSLHIRDV KLSDSGRYDC EAASRIGGHQ RSMHLDIEYA
410 420 430 440 450
PKFVSNQTMY YSWEGNPINI SCDVTANPPA SIHWRREKLL LPAKNTTHLK
460 470 480 490 500
THSVGRKMIL EIAPTSDNDF GRYNCTATNR IGTRFQEYIL ELADVPSSPH
510 520 530 540 550
GVKIIELSQT TAKISFNKPE SHGGVPIHHY QVDVKEVASE TWKIVRSHGV
560 570 580 590 600
QTMVVLSSLE PNTTYEIRVA AVNGKGQGDY SKIEIFQTLP VREPSPPSIH
610 620 630 640 650
GQPSSGKSFK ISITKQDDGG APILEYIVKY RSKDKEDQWL EKKVQGNKDH
660 670 680 690 700
IILEHLQWTM GYEVQITAAN RLGYSEPTVY EFSMPPKPNI IKDTLFNGLG
710 720 730 740 750
LGAIIGLGVA ALLLILVVTD VSCFFIRQCG LLMCITRRMC GKKSGSSGKS
760 770 780 790 800
KELEEGKAAY LKDGSKEPIV EMRTEDERIT NHEDGSPVNE PNETTPLTEP
810 820 830
EKLPLKEENG KEVLNAETIE IKVSNDIIQS KEDDIKA
Length:837
Mass (Da):93,204
Last modified:January 1, 1998 - v1
Checksum:i70473B053A2D65A5
GO
Isoform Short (identifier: O35136-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     694-837: TLFNGLGLGA...IQSKEDDIKA → NCCEANKGENGGQSWHLNAVGFTFVITMSLSCLF

Note: GPI-anchor amidated asparagine on Asn-703.Curated

Show »
Length:727
Mass (Da):81,208
Checksum:iBAE4590B330516C8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei694 – 837144TLFNG…DDIKA → NCCEANKGENGGQSWHLNAV GFTFVITMSLSCLF in isoform Short. 3 PublicationsVSP_002590Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001287 mRNA. Translation: AAB69125.1.
AF001286 mRNA. Translation: AAB69124.1.
AF016619 mRNA. Translation: AAC53375.1.
BC119027 mRNA. Translation: AAI19028.1.
BC119029 mRNA. Translation: AAI19030.1.
CCDSiCCDS28281.1. [O35136-2]
CCDS49888.1. [O35136-1]
RefSeqiNP_001106679.1. NM_001113208.1. [O35136-1]
NP_035084.1. NM_010954.4. [O35136-2]
UniGeneiMm.433941.

Genome annotation databases

EnsembliENSMUST00000037785; ENSMUSP00000049390; ENSMUSG00000022762. [O35136-2]
ENSMUST00000067602; ENSMUSP00000063468; ENSMUSG00000022762. [O35136-1]
GeneIDi17968.
KEGGimmu:17968.
UCSCiuc007zta.2. mouse. [O35136-2]
uc007ztb.2. mouse. [O35136-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001287 mRNA. Translation: AAB69125.1 .
AF001286 mRNA. Translation: AAB69124.1 .
AF016619 mRNA. Translation: AAC53375.1 .
BC119027 mRNA. Translation: AAI19028.1 .
BC119029 mRNA. Translation: AAI19030.1 .
CCDSi CCDS28281.1. [O35136-2 ]
CCDS49888.1. [O35136-1 ]
RefSeqi NP_001106679.1. NM_001113208.1. [O35136-1 ]
NP_035084.1. NM_010954.4. [O35136-2 ]
UniGenei Mm.433941.

3D structure databases

ProteinModelPortali O35136.
SMRi O35136. Positions 19-693.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 201700. 1 interaction.
IntActi O35136. 2 interactions.
MINTi MINT-1177341.

PTM databases

PhosphoSitei O35136.

Proteomic databases

MaxQBi O35136.
PaxDbi O35136.
PRIDEi O35136.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000037785 ; ENSMUSP00000049390 ; ENSMUSG00000022762 . [O35136-2 ]
ENSMUST00000067602 ; ENSMUSP00000063468 ; ENSMUSG00000022762 . [O35136-1 ]
GeneIDi 17968.
KEGGi mmu:17968.
UCSCi uc007zta.2. mouse. [O35136-2 ]
uc007ztb.2. mouse. [O35136-1 ]

Organism-specific databases

CTDi 4685.
MGIi MGI:97282. Ncam2.

Phylogenomic databases

eggNOGi NOG308439.
GeneTreei ENSGT00770000120473.
HOGENOMi HOG000074124.
HOVERGENi HBG052579.
InParanoidi O35136.
KOi K06491.
OMAi EPTISWY.
OrthoDBi EOG75MVVH.
PhylomeDBi O35136.
TreeFami TF326195.

Miscellaneous databases

NextBioi 292909.
PROi O35136.
SOURCEi Search...

Gene expression databases

Bgeei O35136.
CleanExi MM_NCAM2.
ExpressionAtlasi O35136. baseline and differential.
Genevestigatori O35136.

Family and domain databases

Gene3Di 2.60.40.10. 7 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR009138. Neural_cell_adh.
[Graphical view ]
Pfami PF00041. fn3. 2 hits.
PF07679. I-set. 5 hits.
[Graphical view ]
PRINTSi PR01838. NCAMFAMILY.
SMARTi SM00060. FN3. 2 hits.
SM00408. IGc2. 5 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 1 hit.
PROSITEi PS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "OCAM: a new member of the neural cell adhesion molecule family related to zone-to-zone projection of olfactory and vomeronasal axons."
    Yoshihara Y., Kawasaki M., Tamada A., Fujita H., Hayashi H., Kagamiyama H., Mori K.
    J. Neurosci. 17:5830-5842(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT).
    Strain: BALB/c.
    Tissue: Olfactory neuroepithelium.
  2. "Identification of a novel neural cell adhesion molecule-related gene with a potential role in selective axonal projection."
    Alenius M., Bohm S.
    J. Biol. Chem. 272:26083-26086(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
    Strain: C57BL/6J.
    Tissue: Olfactory epithelium.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
    Tissue: Brain.

Entry informationi

Entry nameiNCAM2_MOUSE
AccessioniPrimary (citable) accession number: O35136
Secondary accession number(s): O35962, Q0VF23
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 1, 1998
Last modified: November 26, 2014
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3