O35136 (NCAM2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 118.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neural cell adhesion molecule 2 Short name=N-CAM-2 Short name=NCAM-2 Alternative name(s): Neural cell adhesion molecule RB-8 R4B12 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 837 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons. |
| Subcellular location | Isoform Long: Cell membrane; Single-pass type I membrane protein. Isoform Short: Cell membrane; Lipid-anchor › GPI-anchor. |
| Tissue specificity | Expressed in subsets of both olfactory and vomeronasal neurons in a zone-specific manner. |
| Post-translational modification | The GPI-anchor may be located on 'Asn-703' of isoform Short. |
| Sequence similarities | Contains 2 fibronectin type-III domains. Contains 5 Ig-like C2-type (immunoglobulin-like) domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| PTM | Disulfide bond GPI-anchor Glycoprotein Lipoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | anchored to membrane Inferred from electronic annotation. Source: UniProtKB-KW axonInferred from direct assay PubMed 15677725. Source: MGI integral to membraneInferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: O35136-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: O35136-2) The sequence of this isoform differs from the canonical sequence as follows: 694-837: TLFNGLGLGA...IQSKEDDIKA → NCCEANKGENGGQSWHLNAVGFTFVITMSLSCLF | ||||||
| Note: GPI-anchor amidated asparagine on Asn-703 (Potential). |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Potential | ||||||||
| Chain | 20 – 837 | 818 | Neural cell adhesion molecule 2 | PRO_0000042589 | |||||||
Regions | |||||||||||
| Topological domain | 20 – 697 | 678 | Extracellular Potential | ||||||||
| Transmembrane | 698 – 718 | 21 | Helical; Potential | ||||||||
| Topological domain | 719 – 837 | 119 | Cytoplasmic Potential | ||||||||
| Domain | 21 – 108 | 88 | Ig-like C2-type 1 | ||||||||
| Domain | 113 – 202 | 90 | Ig-like C2-type 2 | ||||||||
| Domain | 208 – 297 | 90 | Ig-like C2-type 3 | ||||||||
| Domain | 302 – 396 | 95 | Ig-like C2-type 4 | ||||||||
| Domain | 401 – 491 | 91 | Ig-like C2-type 5 | ||||||||
| Domain | 496 – 588 | 93 | Fibronectin type-III 1 | ||||||||
| Domain | 590 – 684 | 95 | Fibronectin type-III 2 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 780 | 1 | Phosphothreonine Ref.4 | ||||||||
| Glycosylation | 177 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 219 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 309 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 406 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 419 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 445 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 474 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 562 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 42 ↔ 93 | Probable | |||||||||
| Disulfide bond | 136 ↔ 186 | Probable | |||||||||
| Disulfide bond | 232 ↔ 281 | Probable | |||||||||
| Disulfide bond | 322 ↔ 380 | Probable | |||||||||
| Disulfide bond | 422 ↔ 475 | Probable | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 694 – 837 | 144 | TLFNG…DDIKA → NCCEANKGENGGQSWHLNAV GFTFVITMSLSCLF in isoform Short. | VSP_002590 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "OCAM: a new member of the neural cell adhesion molecule family related to zone-to-zone projection of olfactory and vomeronasal axons." Yoshihara Y., Kawasaki M., Tamada A., Fujita H., Hayashi H., Kagamiyama H., Mori K. J. Neurosci. 17:5830-5842(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT). Strain: BALB/c. Tissue: Olfactory neuroepithelium. |
| [2] | "Identification of a novel neural cell adhesion molecule-related gene with a potential role in selective axonal projection." Alenius M., Bohm S. J. Biol. Chem. 272:26083-26086(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). Strain: C57BL/6J. Tissue: Olfactory epithelium. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). Tissue: Brain. |
| [4] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-780, MASS SPECTROMETRY. Tissue: Brain cortex. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF001287 mRNA. Translation: AAB69125.1. AF001286 mRNA. Translation: AAB69124.1. AF016619 mRNA. Translation: AAC53375.1. BC119027 mRNA. Translation: AAI19028.1. BC119029 mRNA. Translation: AAI19030.1. |
| IPI | IPI00127556. IPI00322617. |
| RefSeq | NP_001106679.1. NM_001113208.1. NP_035084.1. NM_010954.4. |
| UniGene | Mm.433941. |
3D structure databases | |
| ProteinModelPortal | O35136. |
| SMR | O35136. Positions 19-693. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O35136. 1 interaction. |
| MINT | MINT-1177341. |
PTM databases | |
| PhosphoSite | O35136. |
Proteomic databases | |
| PaxDb | O35136. |
| PRIDE | O35136. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000037785; ENSMUSP00000049390; ENSMUSG00000022762. ENSMUST00000067602; ENSMUSP00000063468; ENSMUSG00000022762. |
| GeneID | 17968. |
| KEGG | mmu:17968. |
| UCSC | uc007zta.2. mouse. uc007ztb.2. mouse. |
Organism-specific databases | |
| CTD | 4685. |
| MGI | MGI:97282. Ncam2. |
Phylogenomic databases | |
| eggNOG | NOG308439. |
| GeneTree | ENSGT00680000099931. |
| HOGENOM | HOG000074124. |
| HOVERGEN | HBG052579. |
| InParanoid | O35136. |
| KO | K06491. |
| OMA | EPTISWY. |
| OrthoDB | EOG4MGS6S. |
Gene expression databases | |
| ArrayExpress | O35136. |
| Bgee | O35136. |
| CleanEx | MM_NCAM2. |
| Genevestigator | O35136. |
| GermOnline | ENSMUSG00000022762. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 7 hits. |
| InterPro | IPR003961. Fibronectin_type3. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003598. Ig_sub2. IPR009138. Neural_cell_adh. [Graphical view] |
| Pfam | PF00041. fn3. 2 hits. PF07679. I-set. 5 hits. [Graphical view] |
| PRINTS | PR01838. NCAMFAMILY. |
| SMART | SM00060. FN3. 2 hits. SM00408. IGc2. 5 hits. [Graphical view] |
| SUPFAM | SSF49265. FN_III-like. 2 hits. |
| PROSITE | PS50853. FN3. 2 hits. PS50835. IG_LIKE. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 292909. |
| SOURCE | Search... |
Entry information
| Entry name | NCAM2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O35136 Secondary accession number(s): O35962, Q0VF23 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
