Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neural cell adhesion molecule 2

Gene

Ncam2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processCell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Neural cell adhesion molecule 2
Short name:
N-CAM-2
Short name:
NCAM-2
Alternative name(s):
Neural cell adhesion molecule RB-8
R4B12
Gene namesi
Name:Ncam2
Synonyms:Ocam, Rncam
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:97282 Ncam2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 697ExtracellularSequence analysisAdd BLAST678
Transmembranei698 – 718HelicalSequence analysisAdd BLAST21
Topological domaini719 – 837CytoplasmicSequence analysisAdd BLAST119

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000004258920 – 837Neural cell adhesion molecule 2Add BLAST818

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi42 ↔ 93Curated
Disulfide bondi136 ↔ 186Curated
Glycosylationi177N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi219N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi232 ↔ 281Curated
Glycosylationi309N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi322 ↔ 380Curated
Glycosylationi406N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi419N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi422 ↔ 475Curated
Glycosylationi445N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi474N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi562N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei765PhosphoserineCombined sources1
Modified residuei780PhosphothreonineCombined sources1
Modified residuei786PhosphoserineCombined sources1
Isoform Short (identifier: O35136-2)
Lipidationi703GPI-anchor amidated asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein, Phosphoprotein

Proteomic databases

MaxQBiO35136
PaxDbiO35136
PeptideAtlasiO35136
PRIDEiO35136

PTM databases

iPTMnetiO35136
PhosphoSitePlusiO35136
SwissPalmiO35136

Expressioni

Tissue specificityi

Expressed in subsets of both olfactory and vomeronasal neurons in a zone-specific manner.

Gene expression databases

BgeeiENSMUSG00000022762
CleanExiMM_NCAM2
GenevisibleiO35136 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi201700, 2 interactors
IntActiO35136, 3 interactors
MINTiO35136
STRINGi10090.ENSMUSP00000063468

Structurei

3D structure databases

ProteinModelPortaliO35136
SMRiO35136
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini21 – 108Ig-like C2-type 1Add BLAST88
Domaini113 – 202Ig-like C2-type 2Add BLAST90
Domaini208 – 297Ig-like C2-type 3Add BLAST90
Domaini302 – 396Ig-like C2-type 4Add BLAST95
Domaini401 – 491Ig-like C2-type 5Add BLAST91
Domaini495 – 591Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST97
Domaini593 – 688Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST96

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IQJD Eukaryota
ENOG41118FG LUCA
GeneTreeiENSGT00910000144011
HOGENOMiHOG000074124
HOVERGENiHBG052579
InParanoidiO35136
KOiK06491
OMAiRITNHED
OrthoDBiEOG091G00V0
PhylomeDBiO35136
TreeFamiTF326195

Family and domain databases

CDDicd00063 FN3, 2 hits
Gene3Di2.60.40.10, 7 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR009138 Neural_cell_adh
PfamiView protein in Pfam
PF00041 fn3, 2 hits
PF07679 I-set, 4 hits
PRINTSiPR01838 NCAMFAMILY
SMARTiView protein in SMART
SM00060 FN3, 2 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SM00406 IGv, 3 hits
SUPFAMiSSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853 FN3, 2 hits
PS50835 IG_LIKE, 5 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: O35136-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLLLSFYLL GLLVRSGQAL LQVTISLSKV ELSVGESKFF TCTAIGEPES
60 70 80 90 100
IDWYNPQGEK IISTQRVMLQ KEGVRSRLTI YNANIEDAGI YRCQATDAKG
110 120 130 140 150
QTQEATVVLE IYQKLTFREV VSPQEFKQGE DAEVVCRVSS SPAPAVSWLY
160 170 180 190 200
HNEEVTTIPD NRFAVLANNN LQILNINKSD EGIYRCEGRV EARGEIDFRD
210 220 230 240 250
IIVIVNVPPA IMMPQKSFNA TAERGEEMTL TCKASGSPDP TISWFRNGKL
260 270 280 290 300
IEENEKYILK GSNTELTVRN IINKDGGSYV CKATNKAGED QKQAFLQVFV
310 320 330 340 350
QPHILQLKNE TTSENGHVTL VCEAEGEPVP EITWKRAIDG VMFSEGDKSP
360 370 380 390 400
DGRIEVKGQH GRSSLHIRDV KLSDSGRYDC EAASRIGGHQ RSMHLDIEYA
410 420 430 440 450
PKFVSNQTMY YSWEGNPINI SCDVTANPPA SIHWRREKLL LPAKNTTHLK
460 470 480 490 500
THSVGRKMIL EIAPTSDNDF GRYNCTATNR IGTRFQEYIL ELADVPSSPH
510 520 530 540 550
GVKIIELSQT TAKISFNKPE SHGGVPIHHY QVDVKEVASE TWKIVRSHGV
560 570 580 590 600
QTMVVLSSLE PNTTYEIRVA AVNGKGQGDY SKIEIFQTLP VREPSPPSIH
610 620 630 640 650
GQPSSGKSFK ISITKQDDGG APILEYIVKY RSKDKEDQWL EKKVQGNKDH
660 670 680 690 700
IILEHLQWTM GYEVQITAAN RLGYSEPTVY EFSMPPKPNI IKDTLFNGLG
710 720 730 740 750
LGAIIGLGVA ALLLILVVTD VSCFFIRQCG LLMCITRRMC GKKSGSSGKS
760 770 780 790 800
KELEEGKAAY LKDGSKEPIV EMRTEDERIT NHEDGSPVNE PNETTPLTEP
810 820 830
EKLPLKEENG KEVLNAETIE IKVSNDIIQS KEDDIKA
Length:837
Mass (Da):93,204
Last modified:January 1, 1998 - v1
Checksum:i70473B053A2D65A5
GO
Isoform Short (identifier: O35136-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     694-837: TLFNGLGLGA...IQSKEDDIKA → NCCEANKGENGGQSWHLNAVGFTFVITMSLSCLF

Show »
Length:727
Mass (Da):81,208
Checksum:iBAE4590B330516C8
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002590694 – 837TLFNG…DDIKA → NCCEANKGENGGQSWHLNAV GFTFVITMSLSCLF in isoform Short. 3 PublicationsAdd BLAST144

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001287 mRNA Translation: AAB69125.1
AF001286 mRNA Translation: AAB69124.1
AF016619 mRNA Translation: AAC53375.1
BC119027 mRNA Translation: AAI19028.1
BC119029 mRNA Translation: AAI19030.1
CCDSiCCDS28281.1 [O35136-2]
CCDS49888.1 [O35136-1]
RefSeqiNP_001106679.1, NM_001113208.1 [O35136-1]
NP_035084.1, NM_010954.4 [O35136-2]
UniGeneiMm.433941

Genome annotation databases

EnsembliENSMUST00000037785; ENSMUSP00000049390; ENSMUSG00000022762 [O35136-2]
ENSMUST00000067602; ENSMUSP00000063468; ENSMUSG00000022762 [O35136-1]
GeneIDi17968
KEGGimmu:17968
UCSCiuc007zta.2 mouse [O35136-2]
uc007ztb.2 mouse [O35136-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNCAM2_MOUSE
AccessioniPrimary (citable) accession number: O35136
Secondary accession number(s): O35962, Q0VF23
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 1, 1998
Last modified: March 28, 2018
This is version 157 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health