Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dihydropyrimidinase-related protein 4

Gene

Dpysl4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Protein family/group databases

MEROPSiM38.977.

Names & Taxonomyi

Protein namesi
Recommended name:
Dihydropyrimidinase-related protein 4
Short name:
DRP-4
Alternative name(s):
Collapsin response mediator protein 3
Short name:
CRMP-3
UNC33-like phosphoprotein 4
Short name:
ULIP-4
Gene namesi
Name:Dpysl4
Synonyms:Crmp3, Ulip4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1349764. Dpysl4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001659221 – 572Dihydropyrimidinase-related protein 4Add BLAST572

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei8PhosphoserineBy similarity1
Modified residuei101PhosphothreonineBy similarity1
Modified residuei102PhosphothreonineBy similarity1
Modified residuei258N6-succinyllysineBy similarity1
Modified residuei431PhosphotyrosineBy similarity1
Modified residuei499PhosphotyrosineBy similarity1
Modified residuei521PhosphoserineBy similarity1
Modified residuei537PhosphoserineCombined sources1
Modified residuei540PhosphoserineBy similarity1
Modified residuei542PhosphoserineBy similarity1
Modified residuei544PhosphoserineCombined sources1
Modified residuei565Asymmetric dimethylarginineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiO35098.
PaxDbiO35098.
PeptideAtlasiO35098.
PRIDEiO35098.

2D gel databases

REPRODUCTION-2DPAGEO35098.

PTM databases

iPTMnetiO35098.
PhosphoSitePlusiO35098.
SwissPalmiO35098.

Expressioni

Gene expression databases

BgeeiENSMUSG00000025478.
CleanExiMM_DPYSL4.

Interactioni

Subunit structurei

Homotetramer, and heterotetramer with CRMP1, DPYSL2, DPYSL3 or DPYSL5. Interacts with PLEXA1.3 Publications

GO - Molecular functioni

  • filamin binding Source: MGI
  • phosphoprotein binding Source: BHF-UCL

Protein-protein interaction databases

IntActiO35098. 2 interactors.
MINTiMINT-4093567.
STRINGi10090.ENSMUSP00000026551.

Structurei

3D structure databases

ProteinModelPortaliO35098.
SMRiO35098.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2584. Eukaryota.
COG0044. LUCA.
HOGENOMiHOG000219145.
HOVERGENiHBG000806.
InParanoidiO35098.
PhylomeDBiO35098.

Family and domain databases

CDDicd01314. D-HYD. 1 hit.
Gene3Di2.30.40.10. 2 hits.
InterProiIPR006680. Amidohydro-rel.
IPR030612. DRP4.
IPR011778. Hydantoinase/dihydroPyrase.
IPR011059. Metal-dep_hydrolase_composite.
IPR032466. Metal_Hydrolase.
[Graphical view]
PANTHERiPTHR11647:SF55. PTHR11647:SF55. 1 hit.
PfamiPF01979. Amidohydro_1. 1 hit.
[Graphical view]
SUPFAMiSSF51338. SSF51338. 2 hits.
SSF51556. SSF51556. 1 hit.
TIGRFAMsiTIGR02033. D-hydantoinase. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O35098-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSFQGKKSIP RITSDRLLIK GGKIVNDDQS FHADLYVEDG LIKQIGENLI
60 70 80 90 100
VPGGIKTIDA HGLMVLPGGV DVHTRLQMPV MGMTPADDFC QGTKAALAGG
110 120 130 140 150
TTMILDHVFP DAGVSLLAAY EQWRERADSA ACCDYSLHVD IPRWHESTKE
160 170 180 190 200
ELEALVRDKG VNSFLVFMAY KDRCQCTDGQ IYEIFSLIRD LGAVAQVHAE
210 220 230 240 250
NGDIVEEEQK RLLEQGITGP EGHVLSHPEE VEAEAVYRAV TIAKQANCPL
260 270 280 290 300
YVTKVMSKGA ADMVAQAKRR GVVVFGEPIT ASLGTDGSHY WSKNWAKAAA
310 320 330 340 350
FVTSPPINPD PTTADHLTSL LSSGDLQVTG SAHCTFTTAQ KAVGKDNFTL
360 370 380 390 400
IPEGVNGIEE RMSVVWEKCV ASGKMDENEF VAVTSTNAAK IFNFYPRKGR
410 420 430 440 450
VAVGSDADLV IWNPRATKVF SAKSHNLNVE YNIFEGVECR GVPTVVISQG
460 470 480 490 500
RVVLEDGNLL VTPGAGRFIP RKTFPDFVYK RIKARNRLAE IHGVPRGLYD
510 520 530 540 550
GPVHEVMLPA KPGSGTQARA SCSGKISVPP VRNLHQSGFS LSGSQADDHI
560 570
ARRTAQKIMA PPGGRSNITS LS
Length:572
Mass (Da):61,962
Last modified:January 1, 1998 - v1
Checksum:i37671129FC02C7AF
GO
Isoform 2 (identifier: O35098-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MSFQGKKSIPRIT → MAYKMSQSISVTLGKDIPSRLRCLPQRPLFSLCQ

Note: No experimental confirmation available.
Show »
Length:593
Mass (Da):64,337
Checksum:iF2DE068919E8328C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti125 – 126ER → DG in CAA70299 (PubMed:9652388).Curated2
Sequence conflicti354G → V in CAA70299 (PubMed:9652388).Curated1
Sequence conflicti420F → I in CAA70299 (PubMed:9652388).Curated1
Sequence conflicti420F → I in BAE26556 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0248021 – 13MSFQG…IPRIT → MAYKMSQSISVTLGKDIPSR LRCLPQRPLFSLCQ in isoform 2. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006715 mRNA. Translation: BAA21888.1.
Y09079 mRNA. Translation: CAA70299.1.
AK145638 mRNA. Translation: BAE26556.1.
CCDSiCCDS21951.1. [O35098-1]
UniGeneiMm.250414.

Genome annotation databases

UCSCiuc009kfk.2. mouse. [O35098-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006715 mRNA. Translation: BAA21888.1.
Y09079 mRNA. Translation: CAA70299.1.
AK145638 mRNA. Translation: BAE26556.1.
CCDSiCCDS21951.1. [O35098-1]
UniGeneiMm.250414.

3D structure databases

ProteinModelPortaliO35098.
SMRiO35098.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO35098. 2 interactors.
MINTiMINT-4093567.
STRINGi10090.ENSMUSP00000026551.

Protein family/group databases

MEROPSiM38.977.

PTM databases

iPTMnetiO35098.
PhosphoSitePlusiO35098.
SwissPalmiO35098.

2D gel databases

REPRODUCTION-2DPAGEO35098.

Proteomic databases

MaxQBiO35098.
PaxDbiO35098.
PeptideAtlasiO35098.
PRIDEiO35098.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

UCSCiuc009kfk.2. mouse. [O35098-2]

Organism-specific databases

MGIiMGI:1349764. Dpysl4.

Phylogenomic databases

eggNOGiKOG2584. Eukaryota.
COG0044. LUCA.
HOGENOMiHOG000219145.
HOVERGENiHBG000806.
InParanoidiO35098.
PhylomeDBiO35098.

Miscellaneous databases

PROiO35098.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000025478.
CleanExiMM_DPYSL4.

Family and domain databases

CDDicd01314. D-HYD. 1 hit.
Gene3Di2.30.40.10. 2 hits.
InterProiIPR006680. Amidohydro-rel.
IPR030612. DRP4.
IPR011778. Hydantoinase/dihydroPyrase.
IPR011059. Metal-dep_hydrolase_composite.
IPR032466. Metal_Hydrolase.
[Graphical view]
PANTHERiPTHR11647:SF55. PTHR11647:SF55. 1 hit.
PfamiPF01979. Amidohydro_1. 1 hit.
[Graphical view]
SUPFAMiSSF51338. SSF51338. 2 hits.
SSF51556. SSF51556. 1 hit.
TIGRFAMsiTIGR02033. D-hydantoinase. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiDPYL4_MOUSE
AccessioniPrimary (citable) accession number: O35098
Secondary accession number(s): O08886, Q3UL94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 1, 1998
Last modified: November 2, 2016
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

Lacks most of the conserved residues that are essential for binding the metal cofactor and hence for dihydropyrimidinase activity. Its enzyme activity is therefore unsure.Curated

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.