Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thylakoid lumenal 15 kDa protein 1, chloroplastic

Gene

At2g44920

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Thylakoid lumenal 15 kDa protein 1, chloroplastic
Alternative name(s):
p15
Gene namesi
Ordered Locus Names:At2g44920
ORF Names:T13E15.7
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

TAIRiAT2G44920.

Subcellular locationi

GO - Cellular componenti

  • chloroplast Source: TAIR
  • chloroplast thylakoid Source: TAIR
  • chloroplast thylakoid lumen Source: UniProtKB
  • chloroplast thylakoid membrane Source: TAIR
  • thylakoid Source: TAIR
  • thylakoid lumen Source: TAIR
Complete GO annotation...

Keywords - Cellular componenti

Chloroplast, Plastid, Thylakoid

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 3434ChloroplastSequence analysisAdd
BLAST
Transit peptidei35 – 8147Thylakoid1 PublicationAdd
BLAST
Chaini82 – 224143Thylakoid lumenal 15 kDa protein 1, chloroplasticPRO_0000023523Add
BLAST

Proteomic databases

PaxDbiO22160.
PRIDEiO22160.

Expressioni

Gene expression databases

GenevisibleiO22160. AT.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
trxAP0AA252EBI-2895776,EBI-368542From a different organism.

Protein-protein interaction databases

IntActiO22160. 1 interaction.
STRINGi3702.AT2G44920.2.

Structurei

Secondary structure

1
224
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi82 – 854Combined sources
Helixi90 – 934Combined sources
Helixi196 – 20510Combined sources
Turni211 – 2133Combined sources
Helixi217 – 2204Combined sources
Turni221 – 2244Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3N90X-ray1.70A81-224[»]
ProteinModelPortaliO22160.
SMRiO22160. Positions 81-224.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini116 – 15540Pentapeptide repeat 1Add
BLAST
Domaini156 – 19641Pentapeptide repeat 2Add
BLAST

Sequence similaritiesi

Contains 2 pentapeptide repeat domains.Curated

Keywords - Domaini

Repeat, Transit peptide

Phylogenomic databases

eggNOGiENOG410IGAF. Eukaryota.
ENOG4111W3N. LUCA.
HOGENOMiHOG000232693.
InParanoidiO22160.
OMAiKETLFCK.
PhylomeDBiO22160.

Family and domain databases

InterProiIPR001646. 5peptide_repeat.
[Graphical view]
PfamiPF00805. Pentapeptide. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O22160-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVILSNVSLF SCCNISQKPS LFSPSSRSSH CPIRCSQSQE GKEVVTSPLR
60 70 80 90 100
SVVWSLGEEV SKRSLFALVS ASLFFVDPAL AFKGGGPYGQ GVTRGQDLSG
110 120 130 140 150
KDFSGQTLIR QDFKTSILRQ ANFKGAKLLG ASFFDADLTG ADLSEADLRG
160 170 180 190 200
ADFSLANVTK VNLTNANLEG ATVTGNTSFK GSNITGADFT DVPLRDDQRV
210 220
YLCKVADGVN ATTGNATRDT LLCN
Length:224
Mass (Da):23,779
Last modified:March 27, 2002 - v2
Checksum:iABCECC58F04ADEE4
GO
Isoform 2 (identifier: O22160-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     188-224: DFTDVPLRDDQRVYLCKVADGVNATTGNATRDTLLCN → GEKRKENFHNNNKHISLLPLSFT

Note: No experimental confirmation available.
Show »
Length:210
Mass (Da):22,431
Checksum:i66D41E711A3CFD99
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei188 – 22437DFTDV…TLLCN → GEKRKENFHNNNKHISLLPL SFT in isoform 2. 1 PublicationVSP_004655Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC002388 Genomic DNA. Translation: AAM14836.1.
AC002388 Genomic DNA. Translation: AAC31832.2.
CP002685 Genomic DNA. Translation: AEC10484.1.
CP002685 Genomic DNA. Translation: AEC10485.1.
AY050941 mRNA. No translation available.
BT000902 mRNA. Translation: AAN41302.1.
PIRiT00401.
RefSeqiNP_566030.1. NM_130056.5. [O22160-1]
NP_566031.1. NM_130057.3. [O22160-2]
UniGeneiAt.12323.

Genome annotation databases

EnsemblPlantsiAT2G44920.2; AT2G44920.2; AT2G44920. [O22160-1]
GeneIDi819101.
KEGGiath:AT2G44920.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC002388 Genomic DNA. Translation: AAM14836.1.
AC002388 Genomic DNA. Translation: AAC31832.2.
CP002685 Genomic DNA. Translation: AEC10484.1.
CP002685 Genomic DNA. Translation: AEC10485.1.
AY050941 mRNA. No translation available.
BT000902 mRNA. Translation: AAN41302.1.
PIRiT00401.
RefSeqiNP_566030.1. NM_130056.5. [O22160-1]
NP_566031.1. NM_130057.3. [O22160-2]
UniGeneiAt.12323.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3N90X-ray1.70A81-224[»]
ProteinModelPortaliO22160.
SMRiO22160. Positions 81-224.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO22160. 1 interaction.
STRINGi3702.AT2G44920.2.

Proteomic databases

PaxDbiO22160.
PRIDEiO22160.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT2G44920.2; AT2G44920.2; AT2G44920. [O22160-1]
GeneIDi819101.
KEGGiath:AT2G44920.

Organism-specific databases

TAIRiAT2G44920.

Phylogenomic databases

eggNOGiENOG410IGAF. Eukaryota.
ENOG4111W3N. LUCA.
HOGENOMiHOG000232693.
InParanoidiO22160.
OMAiKETLFCK.
PhylomeDBiO22160.

Miscellaneous databases

PROiO22160.

Gene expression databases

GenevisibleiO22160. AT.

Family and domain databases

InterProiIPR001646. 5peptide_repeat.
[Graphical view]
PfamiPF00805. Pentapeptide. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  2. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  3. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
    Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
    , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
    Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: cv. Columbia.
  4. Cited for: PROTEIN SEQUENCE OF 82-101, SUBCELLULAR LOCATION.
    Strain: cv. Columbia.

Entry informationi

Entry nameiTL15A_ARATH
AccessioniPrimary (citable) accession number: O22160
Secondary accession number(s): Q53YH9, Q949R8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: March 27, 2002
Last modified: November 11, 2015
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.