O19069 (SUCA_PIG) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial EC=6.2.1.4 EC=6.2.1.5 Alternative name(s): Succinyl-CoA synthetase subunit alpha Short name=SCS-alpha | ||
| Gene names |
| ||
| Organism | Sus scrofa (Pig) [Complete proteome] | ||
| Taxonomic identifier | 9823 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Cetartiodactyla › Suina › Suidae › Sus |
Protein attributes
| Sequence length | 346 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the ATP- or GTP-dependent ligation of succinate and CoA to form succinyl-CoA. The nature of the beta subunit determines the nucleotide specificity By similarity. |
| Catalytic activity | GTP + succinate + CoA = GDP + phosphate + succinyl-CoA. ATP + succinate + CoA = ADP + phosphate + succinyl-CoA. |
| Pathway | |
| Subunit structure | Heterodimer of an alpha and a beta subunit. |
| Subcellular location | Mitochondrion By similarity. |
| Tissue specificity | Isoform I is expressed in all tissues examined: liver, brain, heart, and skeletal muscle. Isoform II is expressed only in heart and skeletal muscle. |
| Sequence similarities | Belongs to the succinate/malate CoA ligase alpha subunit family. |
| Sequence caution | The sequence AAB94003.1 differs from that shown. Reason: Erroneous initiation. The sequence AAB94004.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Tricarboxylic acid cycle |
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Ligand | GTP-binding Nucleotide-binding |
| Molecular function | Ligase |
| PTM | Acetylation Isopeptide bond Phosphoprotein Ubl conjugation |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | tricarboxylic acid cycle Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | ATP citrate synthase activity Inferred from electronic annotation. Source: InterPro GTP bindingInferred from electronic annotation. Source: UniProtKB-KW succinate-CoA ligase (ADP-forming) activityInferred from electronic annotation. Source: EC succinate-CoA ligase (GDP-forming) activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform I (identifier: O19069-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform II (identifier: O19069-1) The sequence of this isoform differs from the canonical sequence as follows: 178-196: PGECKIGIMPGHIHKKGRI → RFLRFAVYITSRVFTCTQQEEYRKIPLLFGTRSIHM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 40 | 40 | Mitochondrion By similarity | ||||||||||||||||||||||||||||||||||||
| Chain | 41 – 346 | 306 | Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial | PRO_0000033342 | |||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||
| Active site | 299 | 1 | Tele-phosphohistidine intermediate By similarity | ||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 54 | 1 | N6-acetyllysine By similarity | ||||||||||||||||||||||||||||||||||||
| Cross-link | 280 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) By similarity | |||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 178 – 196 | 19 | PGECK…KKGRI → RFLRFAVYITSRVFTCTQQE EYRKIPLLFGTRSIHM in isoform II. | VSP_036394 | |||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2 – 4 | 3 | TAA → PAG in AAB94003. Ref.2 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2 – 4 | 3 | TAA → PAG in AAB94004. Ref.2 | ||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||
| Helix | 44 – 50 | 7 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 57 – 61 | 5 | |||||||||||||||||||||||||||||||||||||
| Helix | 70 – 77 | 8 | |||||||||||||||||||||||||||||||||||||
| Helix | 104 – 110 | 7 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 115 – 118 | 4 | |||||||||||||||||||||||||||||||||||||
| Helix | 122 – 134 | 13 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 138 – 142 | 5 | |||||||||||||||||||||||||||||||||||||
| Helix | 149 – 159 | 11 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 166 – 168 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 205 – 215 | 11 | |||||||||||||||||||||||||||||||||||||
| Helix | 236 – 245 | 10 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 253 – 255 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 262 – 273 | 12 | |||||||||||||||||||||||||||||||||||||
| Helix | 312 – 320 | 9 | |||||||||||||||||||||||||||||||||||||
| Helix | 335 – 342 | 8 | |||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PEDE (Pig EST Data Explorer): construction of a database for ESTs derived from porcine full-length cDNA libraries." Uenishi H., Eguchi T., Suzuki K., Sawazaki T., Toki D., Shinkai H., Okumura N., Hamasima N., Awata T. Nucleic Acids Res. 32:D484-D488(2004) [PubMed: 14681463] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-291 (ISOFORM I). |
| [2] | "Mutually exclusive splicing generates two distinct isoforms of pig heart succinyl-CoA synthetase." Ryan D.G., Lin T., Brownie E., Bridger W.A., Wolodko W.T. J. Biol. Chem. 272:21151-21159(1997) [PubMed: 9261120] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2-346 (ISOFORMS I AND II), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 133-234, ALTERNATIVE SPLICING. Tissue: Heart. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | BP167826 mRNA. No translation available. AF008432, AF008430 Genomic DNA. Translation: AAB94001.1. AF008433, AF008430, AF008431 Genomic DNA. Translation: AAB94002.2. AF008588 mRNA. Translation: AAB94003.1. Different initiation. AF008589 mRNA. Translation: AAB94004.1. Different initiation. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_999574.1. NM_214409.1. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Ssc.14502. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | O19069. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| STRING | O19069. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| GeneID | 399539. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | ssc:399539. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 8802. | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00530000063275. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000957. | ||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4WQ136. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR017440. Cit_synth/succinyl-CoA_lig_AS. IPR003781. CoA-bd. IPR005810. CoA_lig_alpha. IPR005811. CoA_ligase. IPR016040. NAD(P)-bd_dom. IPR016102. Succinyl-CoA_synth-like. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.40.50.720. NAD(P)-bd. 1 hit. G3DSA:3.40.50.261. Succinyl-CoA_synth-like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K01899. | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF02629. CoA_binding. 1 hit. PF00549. Ligase_CoA. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF001553. SucCS_alpha. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR01798. SCOASYNTHASE. | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00881. CoA_binding. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF52210. CoA_ligase. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR01019. SucCoAalpha. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS01216. SUCCINYL_COA_LIG_1. 1 hit. PS00399. SUCCINYL_COA_LIG_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SUCA_PIG | ||||||||
| Accession | Primary (citable) accession number: O19069 Secondary accession number(s): O19068 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with