SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15540

- FABP7_HUMAN

UniProt

O15540 - FABP7_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fatty acid-binding protein, brain

Gene
FABP7, BLBP, FABPB, MRG
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers By similarity.

GO - Molecular functioni

  1. lipid binding Source: ProtInc
  2. transporter activity Source: InterPro

GO - Biological processi

  1. cell proliferation in forebrain Source: Ensembl
  2. epithelial cell proliferation Source: Ensembl
  3. negative regulation of cell proliferation Source: ProtInc
  4. nervous system development Source: ProtInc
  5. neurogenesis Source: Ensembl
  6. prepulse inhibition Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

Lipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Fatty acid-binding protein, brain
Alternative name(s):
Brain lipid-binding protein
Short name:
BLBP
Brain-type fatty acid-binding protein
Short name:
B-FABP
Fatty acid-binding protein 7
Mammary-derived growth inhibitor related
Gene namesi
Name:FABP7
Synonyms:BLBP, FABPB, MRG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:3562. FABP7.

Subcellular locationi

GO - Cellular componenti

  1. cell projection Source: Ensembl
  2. cytoplasm Source: UniProtKB-SubCell
  3. neuronal cell body Source: Ensembl
  4. nucleus Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27963.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed By similarity
Chaini2 – 132131Fatty acid-binding protein, brainPRO_0000067373Add
BLAST

Proteomic databases

PaxDbiO15540.
PRIDEiO15540.

2D gel databases

DOSAC-COBS-2DPAGEO15540.

PTM databases

PhosphoSiteiO15540.

Expressioni

Tissue specificityi

Expressed in brain and other neural tissues.

Gene expression databases

ArrayExpressiO15540.
BgeeiO15540.
CleanExiHS_FABP7.
GenevestigatoriO15540.

Organism-specific databases

HPAiCAB025488.
CAB058697.
HPA028825.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000357429.

Structurei

Secondary structure

1
132
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi3 – 53
Beta strandi7 – 1610
Helixi17 – 237
Helixi28 – 369
Beta strandi40 – 467
Beta strandi49 – 557
Beta strandi63 – 653
Beta strandi71 – 744
Turni76 – 783
Beta strandi80 – 889
Beta strandi91 – 988
Beta strandi101 – 11010
Beta strandi113 – 1208
Beta strandi123 – 1319

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1FDQX-ray2.10A/B2-132[»]
1FE3X-ray2.80A2-132[»]
1JJXNMR-A2-132[»]
ProteinModelPortaliO15540.
SMRiO15540. Positions 2-132.

Miscellaneous databases

EvolutionaryTraceiO15540.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni127 – 1293Fatty acid binding

Domaini

Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG241430.
HOGENOMiHOG000004829.
HOVERGENiHBG005633.
KOiK08756.
OMAiPTIVISH.
OrthoDBiEOG7NW6BZ.
PhylomeDBiO15540.
TreeFamiTF316894.

Family and domain databases

Gene3Di2.40.128.20. 1 hit.
InterProiIPR012674. Calycin.
IPR011038. Calycin-like.
IPR000463. Fatty_acid-bd.
IPR000566. Lipocln_cytosolic_FA-bd_dom.
[Graphical view]
PfamiPF00061. Lipocalin. 1 hit.
[Graphical view]
PRINTSiPR00178. FATTYACIDBP.
SUPFAMiSSF50814. SSF50814. 1 hit.
PROSITEiPS00214. FABP. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O15540-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVEAFCATWK LTNSQNFDEY MKALGVGFAT RQVGNVTKPT VIISQEGDKV    50
VIRTLSTFKN TEISFQLGEE FDETTADDRN CKSVVSLDGD KLVHIQKWDG 100
KETNFVREIK DGKMVMTLTF GDVVAVRHYE KA 132
Length:132
Mass (Da):14,889
Last modified:January 23, 2007 - v3
Checksum:iF1E8EE12B9474B97
GO
Isoform 2 (identifier: O15540-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-132: TLTFGDVVAVRHYEKA → VSNDNSPFFLVFFSSPHTSHLLPSSSLLLPFFLLPSFFNNTSLARFFNYM

Show »
Length:166
Mass (Da):18,829
Checksum:i4E88C1139530F07A
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti61 – 611T → M.
Corresponds to variant rs2279381 [ dbSNP | Ensembl ].
VAR_049012

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei117 – 13216TLTFG…HYEKA → VSNDNSPFFLVFFSSPHTSH LLPSSSLLLPFFLLPSFFNN TSLARFFNYM in isoform 2. VSP_055490Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti60 – 601N → D in BAA23324. 1 Publication
Sequence conflicti110 – 1101K → R in CAG33338. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ002962 mRNA. Translation: CAA05773.1.
D88648 mRNA. Translation: BAA23645.1.
U51338 mRNA. Translation: AAB87141.1.
D50373 mRNA. Translation: BAA23324.1.
U81235 mRNA. Translation: AAD00507.1.
CR457057 mRNA. Translation: CAG33338.1.
AK289836 mRNA. Translation: BAF82525.1.
AK311867 mRNA. Translation: BAG34808.1.
AL512688 mRNA. Translation: CAC21646.1.
AL645811 Genomic DNA. Translation: CAI15449.1.
CH471051 Genomic DNA. Translation: EAW48166.1.
CH471051 Genomic DNA. Translation: EAW48167.1.
BC012299 mRNA. Translation: AAH12299.1.
CCDSiCCDS5127.1.
RefSeqiNP_001437.1. NM_001446.3.
UniGeneiHs.26770.

Genome annotation databases

EnsembliENST00000356535; ENSP00000348931; ENSG00000164434.
ENST00000368444; ENSP00000357429; ENSG00000164434.
GeneIDi2173.
KEGGihsa:2173.
UCSCiuc003pzf.3. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ002962 mRNA. Translation: CAA05773.1 .
D88648 mRNA. Translation: BAA23645.1 .
U51338 mRNA. Translation: AAB87141.1 .
D50373 mRNA. Translation: BAA23324.1 .
U81235 mRNA. Translation: AAD00507.1 .
CR457057 mRNA. Translation: CAG33338.1 .
AK289836 mRNA. Translation: BAF82525.1 .
AK311867 mRNA. Translation: BAG34808.1 .
AL512688 mRNA. Translation: CAC21646.1 .
AL645811 Genomic DNA. Translation: CAI15449.1 .
CH471051 Genomic DNA. Translation: EAW48166.1 .
CH471051 Genomic DNA. Translation: EAW48167.1 .
BC012299 mRNA. Translation: AAH12299.1 .
CCDSi CCDS5127.1.
RefSeqi NP_001437.1. NM_001446.3.
UniGenei Hs.26770.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1FDQ X-ray 2.10 A/B 2-132 [» ]
1FE3 X-ray 2.80 A 2-132 [» ]
1JJX NMR - A 2-132 [» ]
ProteinModelPortali O15540.
SMRi O15540. Positions 2-132.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000357429.

Chemistry

DrugBanki DB00132. Alpha-Linolenic Acid.
DB00154. gamma-Homolinolenic acid.
DB00159. Icosapent.

PTM databases

PhosphoSitei O15540.

2D gel databases

DOSAC-COBS-2DPAGE O15540.

Proteomic databases

PaxDbi O15540.
PRIDEi O15540.

Protocols and materials databases

DNASUi 2173.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000356535 ; ENSP00000348931 ; ENSG00000164434 .
ENST00000368444 ; ENSP00000357429 ; ENSG00000164434 .
GeneIDi 2173.
KEGGi hsa:2173.
UCSCi uc003pzf.3. human.

Organism-specific databases

CTDi 2173.
GeneCardsi GC06P123142.
HGNCi HGNC:3562. FABP7.
HPAi CAB025488.
CAB058697.
HPA028825.
MIMi 602965. gene.
neXtProti NX_O15540.
PharmGKBi PA27963.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG241430.
HOGENOMi HOG000004829.
HOVERGENi HBG005633.
KOi K08756.
OMAi PTIVISH.
OrthoDBi EOG7NW6BZ.
PhylomeDBi O15540.
TreeFami TF316894.

Miscellaneous databases

EvolutionaryTracei O15540.
GeneWikii FABP7.
GenomeRNAii 2173.
NextBioi 8777.
PROi O15540.
SOURCEi Search...

Gene expression databases

ArrayExpressi O15540.
Bgeei O15540.
CleanExi HS_FABP7.
Genevestigatori O15540.

Family and domain databases

Gene3Di 2.40.128.20. 1 hit.
InterProi IPR012674. Calycin.
IPR011038. Calycin-like.
IPR000463. Fatty_acid-bd.
IPR000566. Lipocln_cytosolic_FA-bd_dom.
[Graphical view ]
Pfami PF00061. Lipocalin. 1 hit.
[Graphical view ]
PRINTSi PR00178. FATTYACIDBP.
SUPFAMi SSF50814. SSF50814. 1 hit.
PROSITEi PS00214. FABP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human brain-type fatty acid binding protein shows high affinity for omega-3 fatty acids but not for omega-6 fatty acids."
    Schnuetgen F., Boerchers T., Xhong N., Godbout R., Sacchettini J.C., Spener F.
    Submitted (NOV-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Isolation and expression of a cDNA for human brain fatty acid-binding protein (B-FABP)."
    Shimizu F., Watanabe T.K., Shinomiya H., Nakamura Y., Fujiwara T.
    Biochim. Biophys. Acta 1354:24-28(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Correlation of B-FABP and GFAP expression in malignant glioma."
    Godbout R., Bisgrove D.A., Shkolny D., Day R.S. III
    Oncogene 16:1955-1962(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Retina.
  4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Fetal brain.
  5. "Identification and characterization of a novel human tumor suppressor gene with homology to mammary derived growth inhibitor."
    Shi Y.E., Ni J.
    Submitted (DEC-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  6. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  9. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Mammary gland.
  12. Lubec G., Vishwanath V., Chen W.-Q., Sun Y.
    Submitted (DEC-2008) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 11-53; 60-79; 83-97 AND 114-127, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Brain, Cajal-Retzius cell and Fetal brain cortex.
  13. "Crystal structure and thermodynamic analysis of human brain fatty acid-binding protein."
    Balendiran G.K., Schnuetgen F., Scapin G., Boerchers T., Xhong N., Lim K., Godbout R., Spener F., Sacchettini J.C.
    J. Biol. Chem. 275:27045-27054(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) IN COMPLEX WITH FATTY ACID.
  14. "Solution structure of fatty acid-binding protein from human brain."
    Rademacher M., Zimmerman A.W., Rueterjans H., Veerkamp J.H., Luecke C.
    Mol. Cell. Biochem. 239:61-68(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR.

Entry informationi

Entry nameiFABP7_HUMAN
AccessioniPrimary (citable) accession number: O15540
Secondary accession number(s): B2R4L1
, O14951, Q6IAU7, Q9H047
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 23, 2007
Last modified: September 3, 2014
This is version 128 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi