O15535 (ZSC9_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 128.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger and SCAN domain-containing protein 9 Alternative name(s): Cell proliferation-inducing gene 12 protein PRD51 Zinc finger protein 193 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 394 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May be involved in transcriptional regulation. |
| Subcellular location | Nucleus Potential. |
| Sequence similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. Contains 5 C2H2-type zinc fingers. Contains 1 SCAN box domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW viral reproductionInferred from electronic annotation. Source: InterPro |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW sequence-specific DNA binding transcription factor activityInferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15535-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15535-2) The sequence of this isoform differs from the canonical sequence as follows: 189-189: T → TDLIRSLRRRAVLIPLGAHLFSTDTFLFSKPVVIPQLKGGGETWPNNRGVLR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 394 | 394 | Zinc finger and SCAN domain-containing protein 9 | PRO_0000047446 | |||||
Regions | |||||||||
| Domain | 52 – 134 | 83 | SCAN box | ||||||
| Zinc finger | 254 – 276 | 23 | C2H2-type 1 | ||||||
| Zinc finger | 282 – 304 | 23 | C2H2-type 2 | ||||||
| Zinc finger | 310 – 332 | 23 | C2H2-type 3 | ||||||
| Zinc finger | 338 – 360 | 23 | C2H2-type 4 | ||||||
| Zinc finger | 366 – 388 | 23 | C2H2-type 5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 189 | 1 | T → TDLIRSLRRRAVLIPLGAHL FSTDTFLFSKPVVIPQLKGG GETWPNNRGVLR in isoform 2. | VSP_044798 | |||||
Experimental info | |||||||||
| Sequence conflict | 7 | 1 | E → G in BAG64928. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Three genes encoding zinc finger proteins on human chromosome 6p21.3: members of a new subclass of the Kruppel gene family containing the conserved SCAN box domain." Lee P.L., Gelbart T., West C., Adams M., Blackstone R., Beutler E. Genomics 43:191-201(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1). Tissue: Duodenum. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Trachea. |
| [3] | "Identification of a human cell proliferation inducing gene." Kim J.W. Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U62392 mRNA. Translation: AAC51659.1. U88082, U88081 Genomic DNA. Translation: AAC51661.1. AK304013 mRNA. Translation: BAG64928.1. AY550973 mRNA. Translation: AAT52219.1. AL022393 Genomic DNA. Translation: CAA18533.1. CH471081 Genomic DNA. Translation: EAX03140.1. BC010374 mRNA. Translation: AAH10374.1. |
| IPI | IPI00007330. IPI00909838. |
| RefSeq | NP_001186408.1. NM_001199479.1. NP_001186409.1. NM_001199480.1. NP_006290.1. NM_006299.4. |
| UniGene | Hs.100921. Hs.731936. |
3D structure databases | |
| ProteinModelPortal | O15535. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O15535. 1 interaction. |
| MINT | MINT-1483710. |
| STRING | 9606.ENSP00000252207. |
PTM databases | |
| PhosphoSite | O15535. |
Proteomic databases | |
| PaxDb | O15535. |
| PRIDE | O15535. |
Protocols and materials databases | |
| DNASU | 7746. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000252207; ENSP00000252207; ENSG00000137185. ENST00000425468; ENSP00000404074; ENSG00000137185. ENST00000531979; ENSP00000433402; ENSG00000137185. |
| GeneID | 7746. |
| KEGG | hsa:7746. |
| UCSC | uc003nkq.2. human. |
Organism-specific databases | |
| CTD | 7746. |
| GeneCards | GC06P028193. |
| HGNC | HGNC:12984. ZSCAN9. |
| MIM | 602246. gene. |
| neXtProt | NX_O15535. |
| PharmGKB | PA37564. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG330991. |
| HOGENOM | HOG000234619. |
| HOVERGEN | HBG018163. |
| InParanoid | O15535. |
| KO | K09230. |
| OMA | HEMVAYR. |
| OrthoDB | EOG4FXR7R. |
| PhylomeDB | O15535. |
Gene expression databases | |
| ArrayExpress | O15535. |
| Bgee | O15535. |
| CleanEx | HS_ZNF193. |
| Genevestigator | O15535. |
| GermOnline | ENSG00000137185. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.160.60. 5 hits. |
| InterPro | IPR008916. Retrov_capsid_C. IPR003309. Tscrpt_reg_SCAN. IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| Pfam | PF02023. SCAN. 1 hit. [Graphical view] |
| SMART | SM00431. SCAN. 1 hit. SM00355. ZnF_C2H2. 5 hits. [Graphical view] |
| SUPFAM | SSF47353. Retrov_capsid_C. 1 hit. |
| PROSITE | PS50804. SCAN_BOX. 1 hit. PS00028. ZINC_FINGER_C2H2_1. 5 hits. PS50157. ZINC_FINGER_C2H2_2. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 7746. |
| NextBio | 29980. |
| SOURCE | Search... |
Entry information
| Entry name | ZSC9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15535 Secondary accession number(s): B4E1W6, E7EVQ2, Q2TTR1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
