Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger and SCAN domain-containing protein 9

Gene

ZSCAN9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri254 – 27623C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri282 – 30423C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri310 – 33223C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri338 – 36023C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri366 – 38823C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger and SCAN domain-containing protein 9
Alternative name(s):
Cell proliferation-inducing gene 12 protein
PRD51
Zinc finger protein 193
Gene namesi
Name:ZSCAN9
Synonyms:ZNF193
ORF Names:PIG12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:12984. ZSCAN9.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37564.

Polymorphism and mutation databases

BioMutaiZSCAN9.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 394394Zinc finger and SCAN domain-containing protein 9PRO_0000047446Add
BLAST

Proteomic databases

MaxQBiO15535.
PeptideAtlasiO15535.
PRIDEiO15535.

PTM databases

iPTMnetiO15535.
PhosphoSiteiO15535.

Expressioni

Gene expression databases

BgeeiENSG00000137185.
CleanExiHS_ZNF193.
ExpressionAtlasiO15535. baseline and differential.
GenevisibleiO15535. HS.

Organism-specific databases

HPAiHPA054512.
HPA059951.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
MAGEH1Q9H2133EBI-751531,EBI-473834
SRPK2P783623EBI-751531,EBI-593303
ZNF446Q96AF54EBI-751531,EBI-740232

Protein-protein interaction databases

BioGridi113530. 8 interactions.
IntActiO15535. 6 interactions.
MINTiMINT-1483710.

Structurei

3D structure databases

ProteinModelPortaliO15535.
SMRiO15535. Positions 49-135, 229-389.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini52 – 13483SCAN boxPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 SCAN box domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri254 – 27623C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri282 – 30423C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri310 – 33223C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri338 – 36023C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri366 – 38823C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00760000118881.
HOGENOMiHOG000234619.
HOVERGENiHBG018163.
InParanoidiO15535.
KOiK09230.
OMAiRKDCPKI.
OrthoDBiEOG091G09O3.
PhylomeDBiO15535.
TreeFamiTF338304.

Family and domain databases

Gene3Di3.30.160.60. 5 hits.
InterProiIPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 2 hits.
PF13912. zf-C2H2_6. 2 hits.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 5 hits.
[Graphical view]
SUPFAMiSSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15535-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNTNSKEVLS LGVQVPEAWE ELLTMKVEAK SHLQWQESRL KRSNPLAREI
60 70 80 90 100
FRRHFRQLCY QETPGPREAL TRLQELCYQW LRPHVSTKEQ ILDLLVLEQF
110 120 130 140 150
LSILPKELQG WVREHCPESG EEAVILLEDL ERELDEPQHE MVAHRHRQEV
160 170 180 190 200
LCKEMVPLAE QTPLTLQSQP KEPQLTCDSA QKCHSIGETD EVTKTEDREL
210 220 230 240 250
VLRKDCPKIV EPHGKMFNEQ TWEVSQQDPS HGEVGEHKDR IERQWGNLLG
260 270 280 290 300
EGQHKCDECG KSFTQSSGLI RHQRIHTGER PYECNECGKA FSRSSGLFNH
310 320 330 340 350
RGIHNIQKRY HCKECGKVFS QSAGLIQHQR IHKGEKPYQC SQCSKSYSRR
360 370 380 390
SFLIEHQRSH TGERPHQCIE CGKSFNRHCN LIRHQKIHTV AELV
Length:394
Mass (Da):45,954
Last modified:January 1, 1998 - v1
Checksum:i4CEC2BBC3E39EA40
GO
Isoform 2 (identifier: O15535-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-189: T → TDLIRSLRRRAVLIPLGAHLFSTDTFLFSKPVVIPQLKGGGETWPNNRGVLR

Note: No experimental confirmation available.
Show »
Length:445
Mass (Da):51,650
Checksum:i8D955B1226963018
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti7 – 71E → G in BAG64928 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei189 – 1891T → TDLIRSLRRRAVLIPLGAHL FSTDTFLFSKPVVIPQLKGG GETWPNNRGVLR in isoform 2. 1 PublicationVSP_044798

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U62392 mRNA. Translation: AAC51659.1.
U88082, U88081 Genomic DNA. Translation: AAC51661.1.
AK304013 mRNA. Translation: BAG64928.1.
AY550973 mRNA. Translation: AAT52219.1.
AL022393 Genomic DNA. Translation: CAA18533.1.
CH471081 Genomic DNA. Translation: EAX03140.1.
BC010374 mRNA. Translation: AAH10374.1.
CCDSiCCDS4646.1. [O15535-1]
CCDS56407.1. [O15535-2]
RefSeqiNP_001186408.1. NM_001199479.1. [O15535-2]
NP_001186409.1. NM_001199480.1. [O15535-1]
NP_006290.1. NM_006299.4. [O15535-1]
UniGeneiHs.100921.
Hs.731936.

Genome annotation databases

EnsembliENST00000252207; ENSP00000252207; ENSG00000137185. [O15535-1]
ENST00000425468; ENSP00000404074; ENSG00000137185. [O15535-2]
ENST00000531979; ENSP00000433402; ENSG00000137185. [O15535-1]
GeneIDi7746.
KEGGihsa:7746.
UCSCiuc003nkq.3. human. [O15535-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U62392 mRNA. Translation: AAC51659.1.
U88082, U88081 Genomic DNA. Translation: AAC51661.1.
AK304013 mRNA. Translation: BAG64928.1.
AY550973 mRNA. Translation: AAT52219.1.
AL022393 Genomic DNA. Translation: CAA18533.1.
CH471081 Genomic DNA. Translation: EAX03140.1.
BC010374 mRNA. Translation: AAH10374.1.
CCDSiCCDS4646.1. [O15535-1]
CCDS56407.1. [O15535-2]
RefSeqiNP_001186408.1. NM_001199479.1. [O15535-2]
NP_001186409.1. NM_001199480.1. [O15535-1]
NP_006290.1. NM_006299.4. [O15535-1]
UniGeneiHs.100921.
Hs.731936.

3D structure databases

ProteinModelPortaliO15535.
SMRiO15535. Positions 49-135, 229-389.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113530. 8 interactions.
IntActiO15535. 6 interactions.
MINTiMINT-1483710.

PTM databases

iPTMnetiO15535.
PhosphoSiteiO15535.

Polymorphism and mutation databases

BioMutaiZSCAN9.

Proteomic databases

MaxQBiO15535.
PeptideAtlasiO15535.
PRIDEiO15535.

Protocols and materials databases

DNASUi7746.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000252207; ENSP00000252207; ENSG00000137185. [O15535-1]
ENST00000425468; ENSP00000404074; ENSG00000137185. [O15535-2]
ENST00000531979; ENSP00000433402; ENSG00000137185. [O15535-1]
GeneIDi7746.
KEGGihsa:7746.
UCSCiuc003nkq.3. human. [O15535-1]

Organism-specific databases

CTDi7746.
GeneCardsiZSCAN9.
HGNCiHGNC:12984. ZSCAN9.
HPAiHPA054512.
HPA059951.
MIMi602246. gene.
neXtProtiNX_O15535.
PharmGKBiPA37564.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118881.
HOGENOMiHOG000234619.
HOVERGENiHBG018163.
InParanoidiO15535.
KOiK09230.
OMAiRKDCPKI.
OrthoDBiEOG091G09O3.
PhylomeDBiO15535.
TreeFamiTF338304.

Miscellaneous databases

GeneWikiiZNF193.
GenomeRNAii7746.
PROiO15535.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000137185.
CleanExiHS_ZNF193.
ExpressionAtlasiO15535. baseline and differential.
GenevisibleiO15535. HS.

Family and domain databases

Gene3Di3.30.160.60. 5 hits.
InterProiIPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 2 hits.
PF13912. zf-C2H2_6. 2 hits.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 5 hits.
[Graphical view]
SUPFAMiSSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZSC9_HUMAN
AccessioniPrimary (citable) accession number: O15535
Secondary accession number(s): B4E1W6, E7EVQ2, Q2TTR1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 1, 1998
Last modified: September 7, 2016
This is version 156 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.