O15533 (TPSN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 135.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tapasin Short name=TPN Short name=TPSN Alternative name(s): NGS-17 TAP-associated protein TAP-binding protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 448 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading). Ref.13 |
| Subunit structure | Heterodimer with PDIA3; disulfide-linked. Interacts with TAP1 and is thus a subunit of the TAP complex, also known as the peptide loading complex (PLC). Interaction with TAP1 is TAP2-independent and is required for efficient peptide-TAP interaction. Obligatory mediator for the interaction between newly assembled MHC class I molecules, clareticulin, PDIA3 and TAP. Up to 4 MHC class I/tapasin complexes bind to 1 TAP. Ref.16 |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass type I membrane protein Probable. |
| Tissue specificity | Neutrophils, mostly in fully differentiated cells. |
| Domain | The N-terminus is required for efficient association with MHC class I molecule and for a stable interaction between MHC I and calreticulin. Binding to TAP is mediated by the C-terminus region. Ref.12 |
| Polymorphism | The 2 alleles of TAPBP; TAPBP*01 (Tapasin*01) (shown here) and TAPBP*02 (Tapasin*02); are in linkage disequilibria with the HLA-DRB1 locus in a Japanese population. |
| Sequence similarities | Contains 1 Ig-like C1-type (immunoglobulin-like) domain. |
| Sequence caution | The sequence AAD32924.2 differs from that shown. Reason: Probable cloning artifact. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TAP1 | Q03518 | 7 | EBI-874801,EBI-747259 | |
| TAP2 | Q03519 | 3 | EBI-874801,EBI-780781 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15533-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15533-2) The sequence of this isoform differs from the canonical sequence as follows: 405-448: LSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE → KSWELCGI | ||||||
| Note: Due to a partial intron retention. | ||||||
| Isoform 3 (identifier: O15533-3) The sequence of this isoform differs from the canonical sequence as follows: 446-448: KAE → VQCSTSLYLSLVTLSPHPISKPMEGGCWCGRQNLGLEFTLIWVKTWHYILTVGLFEHAT | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O15533-4) Also known as: tpsnDeltaEx3; The sequence of this isoform differs from the canonical sequence as follows: 70-156: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 21 – 448 | 428 | Tapasin | PRO_0000014990 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 21 – 414 | 394 | Lumenal Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 415 – 435 | 21 | Helical; Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 436 – 448 | 13 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 292 – 399 | 108 | Ig-like C1-type | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 428 | 1 | May be involved in interaction with TAP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 253 | 1 | N-linked (GlcNAc...) Ref.14 Ref.16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 27 ↔ 91 | Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 115 | Interchain (with C-57 in PDIA3) Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 315 ↔ 382 | Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 70 – 156 | 87 | Missing in isoform 4. | VSP_044455 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 405 – 448 | 44 | LSGPS…KKKAE → KSWELCGI in isoform 2. | VSP_002577 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 446 – 448 | 3 | KAE → VQCSTSLYLSLVTLSPHPIS KPMEGGCWCGRQNLGLEFTL IWVKTWHYILTVGLFEHAT in isoform 3. | VSP_017055 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 260 | 1 | R → T in allele TAPBP*02. Ref.5 Ref.9 Ref.10 Corresponds to variant rs2071888 [ dbSNP | Ensembl ]. | VAR_010253 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 274 | 1 | H → Y in AAH80574. Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 296 | 1 | L → P in ACD68200. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 412 | 1 | D → N in AAD32924. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 23 – 29 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 41 – 46 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 65 – 69 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 74 – 81 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 90 – 96 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 104 – 109 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 112 – 116 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 117 – 119 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 123 – 129 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 141 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 148 – 150 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 153 – 164 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 171 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 176 – 178 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 181 – 184 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 203 – 210 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 213 – 220 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 236 – 242 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 250 – 258 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 263 – 265 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 267 – 275 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 278 – 290 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 293 – 300 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 313 – 323 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 327 – 337 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 345 – 349 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 360 – 367 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 373 – 375 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 379 – 385 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 394 – 399 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and functional characterization of a subunit of the transporter associated with antigen processing." Li S., Sjoegren H.-O., Hellman U., Pettersson R.F., Wang P. Proc. Natl. Acad. Sci. U.S.A. 94:8708-8713(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. Tissue: Lymphoblast. |
| [2] | "A critical role for tapasin in the assembly and function of multimeric MHC class I-TAP complexes." Ortmann B., Copeman J., Lehner P.J., Sadasivan B., Herberg J.A., Grandea A.G., Riddell S.R., Tampe R., Spies T., Trowsdale J., Cresswell P. Science 277:1306-1309(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: B-cell. |
| [3] | "Genomic analysis of the Tapasin gene, located close to the TAP loci in the MHC." Herberg J.A., Sgouros J., Jones T., Copeman J., Humphray S.J., Sheer D., Cresswell P., Beck S., Trowsdale J. Eur. J. Immunol. 28:459-467(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "TAPASIN, DAXX, RGL2, HKE2 and four new genes (BING 1, 3 to 5) form a dense cluster at the centromeric end of the MHC." Herberg J.A., Beck S., Trowsdale J. J. Mol. Biol. 277:839-857(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Polymorphism of TAPASIN and its linkage disequilibria with HLA class II genes in the Japanese population." Furukawa H., Kashiwase K., Yabe T., Ishikawa Y., Akaza T., Tadokoro K., Tohma S., Inoue T., Tokunaga K., Yamamoto K., Juji T. Tissue Antigens 52:279-281(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANT THR-260. Tissue: Lymphocyte. |
| [6] | "Granulocyte-macrophage colony-stimulating factor modulates tapasin expression in human neutrophils." El Ouakfaoui S., Heitz D., Paquin R., Beaulieu A.D. J. Leukoc. Biol. 65:205-210(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Neutrophil. |
| [7] | "Generation of a functional, soluble tapasin protein from an alternatively spliced mRNA." Gao B., Williams A., Sewell A., Elliott T. Genes Immun. 5:101-108(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: B-cell. |
| [8] | "Identification of an alternate splice form of tapasin in human melanoma." Belicha-Villanueva A., Golding M., McEvoy S., Sarvaiya N., Cresswell P., Gollnick S.O., Bangia N. Hum. Immunol. 71:1018-1026(2010) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), ALTERNATIVE SPLICING. Tissue: Melanoma. |
| [9] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-260. |
| [10] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-260. |
| [11] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Prostate. |
| [12] | "The N-terminal region of tapasin is required to stabilize the MHC class I loading complex." Bangia N., Lehner P.J., Hughes E.A., Surman M., Cresswell P. Eur. J. Immunol. 29:1858-1870(1999) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS, DOMAIN CHARACTERIZATION. |
| [13] | "Tapasin is required for efficient peptide binding to transporter associated with antigen processing." Li S., Paulsson K.M., Chen S., Sjoegren H.-O., Wang P. J. Biol. Chem. 275:1581-1586(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [14] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-253, MASS SPECTROMETRY. Tissue: Liver. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [16] | "Insights into MHC class I peptide loading from the structure of the tapasin-ERp57 thiol oxidoreductase heterodimer." Dong G., Wearsch P.A., Peaper D.R., Cresswell P., Reinisch K.M. Immunity 30:21-32(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 1-401 IN COMPLEX WITH PDIA3, SUBUNIT, INTERACTION WITH PDIA3, GLYCOSYLATION AT ASN-253, DISULFIDE BONDS. |
| + | Additional computationally mapped references. |
Web resources
| TAPBPbase TAPBP mutation db |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y13582 mRNA. Translation: CAA73909.1. AF009510 mRNA. Translation: AAC20076.1. AB010639 mRNA. Translation: BAA28757.1. AB012622 Genomic DNA. Translation: BAA28758.1. AB012920 Genomic DNA. Translation: BAA28759.1. AF029750 mRNA. Translation: AAB82949.1. AF067286 mRNA. Translation: AAD32924.2. Sequence problems. AF314222 mRNA. Translation: AAG33061.1. EU693375 mRNA. Translation: ACD68200.1. BX248088 Genomic DNA. Translation: CAI41784.1. AL662827 Genomic DNA. Translation: CAM24888.1. AL662820 Genomic DNA. Translation: CAM25472.1. BX248088 Genomic DNA. Translation: CAM25703.1. CR759817 Genomic DNA. Translation: CAQ08029.1. CR759817 Genomic DNA. Translation: CAQ08031.1. CR759786 Genomic DNA. Translation: CAQ08259.1. CR759786 Genomic DNA. Translation: CAQ08261.1. Z97183 Genomic DNA. No translation available. Z97184 Genomic DNA. No translation available. CH471081 Genomic DNA. Translation: EAX03717.1. BC080574 mRNA. Translation: AAH80574.1. | ||||||||||||
| IPI | IPI00007327. IPI00217384. IPI00645962. IPI00942301. | ||||||||||||
| RefSeq | NP_003181.3. NM_003190.4. NP_757345.2. NM_172208.2. NP_757346.2. NM_172209.2. | ||||||||||||
| UniGene | Hs.370937. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O15533. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O15533. 5 interactions. | ||||||||||||
| MINT | MINT-4053688. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O15533. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O15533. | ||||||||||||
| PRIDE | O15533. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 6892. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000374572; ENSP00000363700; ENSG00000112493. ENST00000383065; ENSP00000372542; ENSG00000206208. ENST00000383066; ENSP00000372543; ENSG00000206208. ENST00000383197; ENSP00000372684; ENSG00000206281. ENST00000383198; ENSP00000372685; ENSG00000206281. ENST00000395114; ENSP00000378546; ENSG00000112493. ENST00000417059; ENSP00000402087; ENSG00000236490. ENST00000426633; ENSP00000404833; ENSG00000231925. ENST00000434618; ENSP00000395701; ENSG00000231925. ENST00000456807; ENSP00000407195; ENSG00000236490. | ||||||||||||
| GeneID | 6892. | ||||||||||||
| KEGG | hsa:6892. | ||||||||||||
| UCSC | uc003odx.2. human. uc003odz.3. human. uc010jut.2. human. uc011drc.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 6892. | ||||||||||||
| GeneCards | GC06M033267. | ||||||||||||
| H-InvDB | HIX0058157. HIX0166135. HIX0166410. | ||||||||||||
| HGNC | HGNC:11566. TAPBP. | ||||||||||||
| HPA | HPA007066. | ||||||||||||
| MIM | 601962. gene. | ||||||||||||
| neXtProt | NX_O15533. | ||||||||||||
| Orphanet | 34592. Immunodeficiency by defective expression of HLA class 1. | ||||||||||||
| PharmGKB | PA36331. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG41000. | ||||||||||||
| HOVERGEN | HBG005156. | ||||||||||||
| KO | K08058. | ||||||||||||
| OrthoDB | EOG469QV7. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O15533. | ||||||||||||
| Bgee | O15533. | ||||||||||||
| Genevestigator | O15533. | ||||||||||||
| GermOnline | ENSG00000112493. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.60.40.10. 1 hit. | ||||||||||||
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003597. Ig_C1-set. IPR008056. Tapasin. [Graphical view] | ||||||||||||
| PANTHER | PTHR23411. PTHR23411. 1 hit. | ||||||||||||
| Pfam | PF07654. C1-set. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR01669. TAPASIN. | ||||||||||||
| PROSITE | PS50835. IG_LIKE. 1 hit. PS00290. IG_MHC. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | TAPBP. human. | ||||||||||||
| EvolutionaryTrace | O15533. | ||||||||||||
| GenomeRNAi | 6892. | ||||||||||||
| NextBio | 26935. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | TPSN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15533 Secondary accession number(s): A2AB91 Q9Y6K2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
