Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15533

- TPSN_HUMAN

UniProt

O15533 - TPSN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tapasin

Gene

TAPBP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading).1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei428 – 4281May be involved in interaction with TAP

GO - Molecular functioni

  1. MHC class I protein binding Source: UniProtKB
  2. peptide antigen binding Source: UniProtKB
  3. peptide antigen-transporting ATPase activity Source: ProtInc
  4. TAP1 binding Source: UniProtKB
  5. TAP2 binding Source: UniProtKB
  6. unfolded protein binding Source: UniProtKB

GO - Biological processi

  1. amide transport Source: GOC
  2. antigen processing and presentation of endogenous peptide antigen via MHC class I Source: InterPro
  3. antigen processing and presentation of exogenous peptide antigen via MHC class I Source: Reactome
  4. antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent Source: Reactome
  5. antigen processing and presentation of peptide antigen via MHC class I Source: Reactome
  6. immune response Source: ProtInc
  7. peptide antigen stabilization Source: UniProtKB
  8. peptide transport Source: GOC
  9. protein complex assembly Source: ProtInc
  10. retrograde vesicle-mediated transport, Golgi to ER Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_111178. ER-Phagosome pathway.
REACT_75795. Antigen Presentation: Folding, assembly and peptide loading of class I MHC.

Names & Taxonomyi

Protein namesi
Recommended name:
Tapasin
Short name:
TPN
Short name:
TPSN
Alternative name(s):
NGS-17
TAP-associated protein
TAP-binding protein
Gene namesi
Name:TAPBP
Synonyms:NGS17, TAPA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:11566. TAPBP.

Subcellular locationi

GO - Cellular componenti

  1. endoplasmic reticulum Source: ProtInc
  2. endoplasmic reticulum membrane Source: UniProtKB
  3. Golgi membrane Source: UniProtKB
  4. integral component of lumenal side of endoplasmic reticulum membrane Source: Reactome
  5. integral component of membrane Source: ProtInc
  6. MHC class I peptide loading complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

Orphaneti34592. Immunodeficiency by defective expression of HLA class 1.
PharmGKBiPA36331.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Add
BLAST
Chaini21 – 448428TapasinPRO_0000014990Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi27 ↔ 911 PublicationPROSITE-ProRule annotation
Disulfide bondi115 – 115Interchain (with C-57 in PDIA3)1 PublicationPROSITE-ProRule annotation
Glycosylationi253 – 2531N-linked (GlcNAc...)2 Publications
Disulfide bondi315 ↔ 3821 PublicationPROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiO15533.
PaxDbiO15533.
PRIDEiO15533.

PTM databases

PhosphoSiteiO15533.

Expressioni

Tissue specificityi

Neutrophils, mostly in fully differentiated cells.

Gene expression databases

BgeeiO15533.
ExpressionAtlasiO15533. baseline and differential.
GenevestigatoriO15533.

Organism-specific databases

HPAiHPA007066.

Interactioni

Subunit structurei

Heterodimer with PDIA3; disulfide-linked. Interacts with TAP1 and is thus a subunit of the TAP complex, also known as the peptide loading complex (PLC). Interaction with TAP1 is TAP2-independent and is required for efficient peptide-TAP interaction. Obligatory mediator for the interaction between newly assembled MHC class I molecules, calreticulin, PDIA3 and TAP. Up to 4 MHC class I/tapasin complexes bind to 1 TAP.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
BNLF2aP0C7395EBI-874801,EBI-9346744From a different organism.
TAP1Q0351812EBI-874801,EBI-747259
TAP2Q035198EBI-874801,EBI-780781

Protein-protein interaction databases

BioGridi112755. 12 interactions.
IntActiO15533. 7 interactions.
MINTiMINT-4053688.

Structurei

Secondary structure

1
448
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi23 – 297Combined sources
Beta strandi41 – 466Combined sources
Beta strandi65 – 695Combined sources
Helixi74 – 818Combined sources
Beta strandi90 – 967Combined sources
Helixi104 – 1096Combined sources
Beta strandi112 – 1165Combined sources
Helixi117 – 1193Combined sources
Beta strandi123 – 1297Combined sources
Beta strandi134 – 1418Combined sources
Beta strandi148 – 1503Combined sources
Beta strandi153 – 16412Combined sources
Beta strandi169 – 1713Combined sources
Beta strandi176 – 1783Combined sources
Beta strandi181 – 1844Combined sources
Beta strandi203 – 2108Combined sources
Beta strandi213 – 2208Combined sources
Beta strandi236 – 2427Combined sources
Beta strandi250 – 2589Combined sources
Helixi263 – 2653Combined sources
Beta strandi267 – 2759Combined sources
Beta strandi278 – 29013Combined sources
Beta strandi293 – 3008Combined sources
Beta strandi313 – 32311Combined sources
Beta strandi327 – 33711Combined sources
Beta strandi345 – 3495Combined sources
Beta strandi360 – 3678Combined sources
Helixi373 – 3753Combined sources
Beta strandi379 – 3857Combined sources
Beta strandi394 – 3996Combined sources

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3F8UX-ray2.60B/D1-401[»]
ProteinModelPortaliO15533.
SMRiO15533. Positions 21-401.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15533.

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini21 – 414394LumenalSequence AnalysisAdd
BLAST
Topological domaini436 – 44813CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei415 – 43521HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini292 – 399108Ig-like C1-typeAdd
BLAST

Domaini

The N-terminus is required for efficient association with MHC class I molecule and for a stable interaction between MHC I and calreticulin. Binding to TAP is mediated by the C-terminal region.1 Publication

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG41000.
HOVERGENiHBG005156.
InParanoidiO15533.
KOiK08058.
OMAiYLATVHL.
PhylomeDBiO15533.
TreeFamiTF334274.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003597. Ig_C1-set.
IPR008056. Tapasin.
[Graphical view]
PfamiPF07654. C1-set. 1 hit.
[Graphical view]
PRINTSiPR01669. TAPASIN.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O15533-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKSLSLLLAV ALGLATAVSA GPAVIECWFV EDASGKGLAK RPGALLLRQG
60 70 80 90 100
PGEPPPRPDL DPELYLSVHD PAGALQAAFR RYPRGAPAPH CEMSRFVPLP
110 120 130 140 150
ASAKWASGLT PAQNCPRALD GAWLMVSISS PVLSLSSLLR PQPEPQQEPV
160 170 180 190 200
LITMATVVLT VLTHTPAPRV RLGQDALLDL SFAYMPPTSE AASSLAPGPP
210 220 230 240 250
PFGLEWRRQH LGKGHLLLAA TPGLNGQMPA AQEGAVAFAA WDDDEPWGPW
260 270 280 290 300
TGNGTFWLPR VQPFQEGTYL ATIHLPYLQG QVTLELAVYK PPKVSLMPAT
310 320 330 340 350
LARAAPGEAP PELLCLVSHF YPSGGLEVEW ELRGGPGGRS QKAEGQRWLS
360 370 380 390 400
ALRHHSDGSV SLSGHLQPPP VTTEQHGARY ACRIHHPSLP ASGRSAEVTL
410 420 430 440
EVAGLSGPSL EDSVGLFLSA FLLLGLFKAL GWAAVYLSTC KDSKKKAE
Length:448
Mass (Da):47,626
Last modified:January 1, 1998 - v1
Checksum:i7340549519B288AD
GO
Isoform 2 (identifier: O15533-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     405-448: LSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE → KSWELCGI

Note: Due to a partial intron retention.

Show »
Length:412
Mass (Da):43,885
Checksum:iE50E3F41AD7E7EA8
GO
Isoform 3 (identifier: O15533-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     446-448: KAE → VQCSTSLYLSLVTLSPHPISKPMEGGCWCGRQNLGLEFTLIWVKTWHYILTVGLFEHAT

Note: No experimental confirmation available.

Show »
Length:504
Mass (Da):53,943
Checksum:iBEF063064284DE16
GO
Isoform 4 (identifier: O15533-4) [UniParc]FASTAAdd to Basket

Also known as: tpsnDeltaEx3

The sequence of this isoform differs from the canonical sequence as follows:
     70-156: Missing.

Show »
Length:361
Mass (Da):38,365
Checksum:iE049AA2C6F0B4DED
GO

Sequence cautioni

The sequence AAD32924.2 differs from that shown. Reason: Probable cloning artifact.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti274 – 2741H → Y in AAH80574. (PubMed:15489334)Curated
Sequence conflicti296 – 2961L → P in ACD68200. (PubMed:20600451)Curated
Sequence conflicti412 – 4121D → N in AAD32924. (PubMed:14668790)Curated

Polymorphismi

The 2 alleles of TAPBP; TAPBP*01 (Tapasin*01) (shown here) and TAPBP*02 (Tapasin*02); are in linkage disequilibria with the HLA-DRB1 locus in a Japanese population.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti260 – 2601R → T in allele TAPBP*02. 3 Publications
Corresponds to variant rs2071888 [ dbSNP | Ensembl ].
VAR_010253

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei70 – 15687Missing in isoform 4. 1 PublicationVSP_044455Add
BLAST
Alternative sequencei405 – 44844LSGPS…KKKAE → KSWELCGI in isoform 2. 1 PublicationVSP_002577Add
BLAST
Alternative sequencei446 – 4483KAE → VQCSTSLYLSLVTLSPHPIS KPMEGGCWCGRQNLGLEFTL IWVKTWHYILTVGLFEHAT in isoform 3. 1 PublicationVSP_017055

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y13582 mRNA. Translation: CAA73909.1.
AF009510 mRNA. Translation: AAC20076.1.
AB010639 mRNA. Translation: BAA28757.1.
AB012622 Genomic DNA. Translation: BAA28758.1.
AB012920 Genomic DNA. Translation: BAA28759.1.
AF029750 mRNA. Translation: AAB82949.1.
AF067286 mRNA. Translation: AAD32924.2. Sequence problems.
AF314222 mRNA. Translation: AAG33061.1.
EU693375 mRNA. Translation: ACD68200.1.
BX248088 Genomic DNA. Translation: CAI41784.1.
AL662827 Genomic DNA. Translation: CAM24888.1.
AL662820 Genomic DNA. Translation: CAM25472.1.
BX248088 Genomic DNA. Translation: CAM25703.1.
CR759817 Genomic DNA. Translation: CAQ08029.1.
CR759817 Genomic DNA. Translation: CAQ08031.1.
CR759786 Genomic DNA. Translation: CAQ08259.1.
CR759786 Genomic DNA. Translation: CAQ08261.1.
Z97183 Genomic DNA. No translation available.
Z97184 Genomic DNA. No translation available.
CH471081 Genomic DNA. Translation: EAX03717.1.
BC080574 mRNA. Translation: AAH80574.1.
CCDSiCCDS34426.1. [O15533-1]
CCDS34427.2. [O15533-4]
CCDS34428.2. [O15533-3]
RefSeqiNP_003181.3. NM_003190.4.
NP_757345.2. NM_172208.2.
NP_757346.2. NM_172209.2.
UniGeneiHs.370937.

Genome annotation databases

EnsembliENST00000374572; ENSP00000363700; ENSG00000112493. [O15533-1]
ENST00000383066; ENSP00000372543; ENSG00000206208.
ENST00000383197; ENSP00000372684; ENSG00000206281. [O15533-3]
ENST00000383198; ENSP00000372685; ENSG00000206281. [O15533-1]
ENST00000395114; ENSP00000378546; ENSG00000112493. [O15533-3]
ENST00000417059; ENSP00000402087; ENSG00000236490. [O15533-1]
ENST00000434618; ENSP00000395701; ENSG00000231925.
ENST00000456807; ENSP00000407195; ENSG00000236490. [O15533-3]
ENST00000549142; ENSP00000448168; ENSG00000206281. [O15533-4]
ENST00000550330; ENSP00000450358; ENSG00000112493. [O15533-4]
ENST00000553235; ENSP00000447823; ENSG00000236490. [O15533-4]
GeneIDi6892.
KEGGihsa:6892.
UCSCiuc003odx.2. human. [O15533-1]
uc003odz.3. human. [O15533-3]
uc010jut.2. human. [O15533-4]
uc011drc.2. human. [O15533-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

TAPBPbase

TAPBP mutation db

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y13582 mRNA. Translation: CAA73909.1 .
AF009510 mRNA. Translation: AAC20076.1 .
AB010639 mRNA. Translation: BAA28757.1 .
AB012622 Genomic DNA. Translation: BAA28758.1 .
AB012920 Genomic DNA. Translation: BAA28759.1 .
AF029750 mRNA. Translation: AAB82949.1 .
AF067286 mRNA. Translation: AAD32924.2 . Sequence problems.
AF314222 mRNA. Translation: AAG33061.1 .
EU693375 mRNA. Translation: ACD68200.1 .
BX248088 Genomic DNA. Translation: CAI41784.1 .
AL662827 Genomic DNA. Translation: CAM24888.1 .
AL662820 Genomic DNA. Translation: CAM25472.1 .
BX248088 Genomic DNA. Translation: CAM25703.1 .
CR759817 Genomic DNA. Translation: CAQ08029.1 .
CR759817 Genomic DNA. Translation: CAQ08031.1 .
CR759786 Genomic DNA. Translation: CAQ08259.1 .
CR759786 Genomic DNA. Translation: CAQ08261.1 .
Z97183 Genomic DNA. No translation available.
Z97184 Genomic DNA. No translation available.
CH471081 Genomic DNA. Translation: EAX03717.1 .
BC080574 mRNA. Translation: AAH80574.1 .
CCDSi CCDS34426.1. [O15533-1 ]
CCDS34427.2. [O15533-4 ]
CCDS34428.2. [O15533-3 ]
RefSeqi NP_003181.3. NM_003190.4.
NP_757345.2. NM_172208.2.
NP_757346.2. NM_172209.2.
UniGenei Hs.370937.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3F8U X-ray 2.60 B/D 1-401 [» ]
ProteinModelPortali O15533.
SMRi O15533. Positions 21-401.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112755. 12 interactions.
IntActi O15533. 7 interactions.
MINTi MINT-4053688.

PTM databases

PhosphoSitei O15533.

Proteomic databases

MaxQBi O15533.
PaxDbi O15533.
PRIDEi O15533.

Protocols and materials databases

DNASUi 6892.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000374572 ; ENSP00000363700 ; ENSG00000112493 . [O15533-1 ]
ENST00000383066 ; ENSP00000372543 ; ENSG00000206208 .
ENST00000383197 ; ENSP00000372684 ; ENSG00000206281 . [O15533-3 ]
ENST00000383198 ; ENSP00000372685 ; ENSG00000206281 . [O15533-1 ]
ENST00000395114 ; ENSP00000378546 ; ENSG00000112493 . [O15533-3 ]
ENST00000417059 ; ENSP00000402087 ; ENSG00000236490 . [O15533-1 ]
ENST00000434618 ; ENSP00000395701 ; ENSG00000231925 .
ENST00000456807 ; ENSP00000407195 ; ENSG00000236490 . [O15533-3 ]
ENST00000549142 ; ENSP00000448168 ; ENSG00000206281 . [O15533-4 ]
ENST00000550330 ; ENSP00000450358 ; ENSG00000112493 . [O15533-4 ]
ENST00000553235 ; ENSP00000447823 ; ENSG00000236490 . [O15533-4 ]
GeneIDi 6892.
KEGGi hsa:6892.
UCSCi uc003odx.2. human. [O15533-1 ]
uc003odz.3. human. [O15533-3 ]
uc010jut.2. human. [O15533-4 ]
uc011drc.2. human. [O15533-2 ]

Organism-specific databases

CTDi 6892.
GeneCardsi GC06M033267.
GC06Mj33189.
GC06Mk33245.
GC06Mm33437.
GC06Mn33196.
H-InvDB HIX0058157.
HIX0166135.
HIX0166410.
HGNCi HGNC:11566. TAPBP.
HPAi HPA007066.
MIMi 601962. gene.
neXtProti NX_O15533.
Orphaneti 34592. Immunodeficiency by defective expression of HLA class 1.
PharmGKBi PA36331.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG41000.
HOVERGENi HBG005156.
InParanoidi O15533.
KOi K08058.
OMAi YLATVHL.
PhylomeDBi O15533.
TreeFami TF334274.

Enzyme and pathway databases

Reactomei REACT_111178. ER-Phagosome pathway.
REACT_75795. Antigen Presentation: Folding, assembly and peptide loading of class I MHC.

Miscellaneous databases

ChiTaRSi TAPBP. human.
EvolutionaryTracei O15533.
GeneWikii Tapasin.
GenomeRNAii 6892.
NextBioi 26935.
PROi O15533.
SOURCEi Search...

Gene expression databases

Bgeei O15533.
ExpressionAtlasi O15533. baseline and differential.
Genevestigatori O15533.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003597. Ig_C1-set.
IPR008056. Tapasin.
[Graphical view ]
Pfami PF07654. C1-set. 1 hit.
[Graphical view ]
PRINTSi PR01669. TAPASIN.
PROSITEi PS50835. IG_LIKE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and functional characterization of a subunit of the transporter associated with antigen processing."
    Li S., Sjoegren H.-O., Hellman U., Pettersson R.F., Wang P.
    Proc. Natl. Acad. Sci. U.S.A. 94:8708-8713(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE.
    Tissue: Lymphoblast.
  2. "A critical role for tapasin in the assembly and function of multimeric MHC class I-TAP complexes."
    Ortmann B., Copeman J., Lehner P.J., Sadasivan B., Herberg J.A., Grandea A.G., Riddell S.R., Tampe R., Spies T., Trowsdale J., Cresswell P.
    Science 277:1306-1309(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: B-cell.
  3. "Genomic analysis of the Tapasin gene, located close to the TAP loci in the MHC."
    Herberg J.A., Sgouros J., Jones T., Copeman J., Humphray S.J., Sheer D., Cresswell P., Beck S., Trowsdale J.
    Eur. J. Immunol. 28:459-467(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. "TAPASIN, DAXX, RGL2, HKE2 and four new genes (BING 1, 3 to 5) form a dense cluster at the centromeric end of the MHC."
    Herberg J.A., Beck S., Trowsdale J.
    J. Mol. Biol. 277:839-857(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. "Polymorphism of TAPASIN and its linkage disequilibria with HLA class II genes in the Japanese population."
    Furukawa H., Kashiwase K., Yabe T., Ishikawa Y., Akaza T., Tadokoro K., Tohma S., Inoue T., Tokunaga K., Yamamoto K., Juji T.
    Tissue Antigens 52:279-281(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANT THR-260.
    Tissue: Lymphocyte.
  6. "Granulocyte-macrophage colony-stimulating factor modulates tapasin expression in human neutrophils."
    El Ouakfaoui S., Heitz D., Paquin R., Beaulieu A.D.
    J. Leukoc. Biol. 65:205-210(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Neutrophil.
  7. "Generation of a functional, soluble tapasin protein from an alternatively spliced mRNA."
    Gao B., Williams A., Sewell A., Elliott T.
    Genes Immun. 5:101-108(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: B-cell.
  8. "Identification of an alternate splice form of tapasin in human melanoma."
    Belicha-Villanueva A., Golding M., McEvoy S., Sarvaiya N., Cresswell P., Gollnick S.O., Bangia N.
    Hum. Immunol. 71:1018-1026(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), ALTERNATIVE SPLICING.
    Tissue: Melanoma.
  9. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-260.
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-260.
  11. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Prostate.
  12. "The N-terminal region of tapasin is required to stabilize the MHC class I loading complex."
    Bangia N., Lehner P.J., Hughes E.A., Surman M., Cresswell P.
    Eur. J. Immunol. 29:1858-1870(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: MUTAGENESIS, DOMAIN CHARACTERIZATION.
  13. "Tapasin is required for efficient peptide binding to transporter associated with antigen processing."
    Li S., Paulsson K.M., Chen S., Sjoegren H.-O., Wang P.
    J. Biol. Chem. 275:1581-1586(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  14. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-253.
    Tissue: Liver.
  15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "Insights into MHC class I peptide loading from the structure of the tapasin-ERp57 thiol oxidoreductase heterodimer."
    Dong G., Wearsch P.A., Peaper D.R., Cresswell P., Reinisch K.M.
    Immunity 30:21-32(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 1-401 IN COMPLEX WITH PDIA3, SUBUNIT, INTERACTION WITH PDIA3, GLYCOSYLATION AT ASN-253, DISULFIDE BONDS.

Entry informationi

Entry nameiTPSN_HUMAN
AccessioniPrimary (citable) accession number: O15533
Secondary accession number(s): A2AB91
, A2ABC0, B0V003, B0V0A6, B2ZUA4, E9PGM2, O15210, O15272, Q5STJ8, Q5STK6, Q5STQ5, Q5STQ6, Q66K65, Q96KK7, Q9HAN8, Q9UEE0, Q9UEE4, Q9UIZ6, Q9Y6K2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: January 1, 1998
Last modified: October 29, 2014
This is version 149 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3