Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O15533

- TPSN_HUMAN

UniProt

O15533 - TPSN_HUMAN

Protein

Tapasin

Gene

TAPBP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 148 (01 Oct 2014)
      Sequence version 1 (01 Jan 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading).1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei428 – 4281May be involved in interaction with TAP

    GO - Molecular functioni

    1. MHC class I protein binding Source: UniProtKB
    2. peptide antigen binding Source: UniProtKB
    3. peptide antigen-transporting ATPase activity Source: ProtInc
    4. protein binding Source: IntAct
    5. TAP1 binding Source: UniProtKB
    6. TAP2 binding Source: UniProtKB
    7. unfolded protein binding Source: UniProtKB

    GO - Biological processi

    1. amide transport Source: GOC
    2. antigen processing and presentation of endogenous peptide antigen via MHC class I Source: InterPro
    3. antigen processing and presentation of exogenous peptide antigen via MHC class I Source: Reactome
    4. antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent Source: Reactome
    5. antigen processing and presentation of peptide antigen via MHC class I Source: Reactome
    6. immune response Source: ProtInc
    7. peptide antigen stabilization Source: UniProtKB
    8. peptide transport Source: GOC
    9. protein complex assembly Source: ProtInc
    10. retrograde vesicle-mediated transport, Golgi to ER Source: UniProtKB

    Enzyme and pathway databases

    ReactomeiREACT_111178. ER-Phagosome pathway.
    REACT_75795. Antigen Presentation: Folding, assembly and peptide loading of class I MHC.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tapasin
    Short name:
    TPN
    Short name:
    TPSN
    Alternative name(s):
    NGS-17
    TAP-associated protein
    TAP-binding protein
    Gene namesi
    Name:TAPBP
    Synonyms:NGS17, TAPA
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:11566. TAPBP.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum Source: ProtInc
    2. endoplasmic reticulum membrane Source: UniProtKB
    3. Golgi membrane Source: UniProtKB
    4. integral component of lumenal side of endoplasmic reticulum membrane Source: Reactome
    5. integral component of membrane Source: ProtInc
    6. MHC class I peptide loading complex Source: UniProtKB

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Organism-specific databases

    Orphaneti34592. Immunodeficiency by defective expression of HLA class 1.
    PharmGKBiPA36331.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2020Add
    BLAST
    Chaini21 – 448428TapasinPRO_0000014990Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi27 ↔ 911 PublicationPROSITE-ProRule annotation
    Disulfide bondi115 – 115Interchain (with C-57 in PDIA3)1 PublicationPROSITE-ProRule annotation
    Glycosylationi253 – 2531N-linked (GlcNAc...)2 Publications
    Disulfide bondi315 ↔ 3821 PublicationPROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiO15533.
    PaxDbiO15533.
    PRIDEiO15533.

    PTM databases

    PhosphoSiteiO15533.

    Expressioni

    Tissue specificityi

    Neutrophils, mostly in fully differentiated cells.

    Gene expression databases

    ArrayExpressiO15533.
    BgeeiO15533.
    GenevestigatoriO15533.

    Organism-specific databases

    HPAiHPA007066.

    Interactioni

    Subunit structurei

    Heterodimer with PDIA3; disulfide-linked. Interacts with TAP1 and is thus a subunit of the TAP complex, also known as the peptide loading complex (PLC). Interaction with TAP1 is TAP2-independent and is required for efficient peptide-TAP interaction. Obligatory mediator for the interaction between newly assembled MHC class I molecules, calreticulin, PDIA3 and TAP. Up to 4 MHC class I/tapasin complexes bind to 1 TAP.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    BNLF2aP0C7395EBI-874801,EBI-9346744From a different organism.
    TAP1Q0351812EBI-874801,EBI-747259
    TAP2Q035198EBI-874801,EBI-780781

    Protein-protein interaction databases

    BioGridi112755. 12 interactions.
    IntActiO15533. 7 interactions.
    MINTiMINT-4053688.

    Structurei

    Secondary structure

    1
    448
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi23 – 297
    Beta strandi41 – 466
    Beta strandi65 – 695
    Helixi74 – 818
    Beta strandi90 – 967
    Helixi104 – 1096
    Beta strandi112 – 1165
    Helixi117 – 1193
    Beta strandi123 – 1297
    Beta strandi134 – 1418
    Beta strandi148 – 1503
    Beta strandi153 – 16412
    Beta strandi169 – 1713
    Beta strandi176 – 1783
    Beta strandi181 – 1844
    Beta strandi203 – 2108
    Beta strandi213 – 2208
    Beta strandi236 – 2427
    Beta strandi250 – 2589
    Helixi263 – 2653
    Beta strandi267 – 2759
    Beta strandi278 – 29013
    Beta strandi293 – 3008
    Beta strandi313 – 32311
    Beta strandi327 – 33711
    Beta strandi345 – 3495
    Beta strandi360 – 3678
    Helixi373 – 3753
    Beta strandi379 – 3857
    Beta strandi394 – 3996

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3F8UX-ray2.60B/D1-401[»]
    ProteinModelPortaliO15533.
    SMRiO15533. Positions 21-401.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO15533.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini21 – 414394LumenalSequence AnalysisAdd
    BLAST
    Topological domaini436 – 44813CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei415 – 43521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini292 – 399108Ig-like C1-typeAdd
    BLAST

    Domaini

    The N-terminus is required for efficient association with MHC class I molecule and for a stable interaction between MHC I and calreticulin. Binding to TAP is mediated by the C-terminal region.1 Publication

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG41000.
    HOVERGENiHBG005156.
    KOiK08058.
    OMAiYLATVHL.
    PhylomeDBiO15533.
    TreeFamiTF334274.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003597. Ig_C1-set.
    IPR008056. Tapasin.
    [Graphical view]
    PfamiPF07654. C1-set. 1 hit.
    [Graphical view]
    PRINTSiPR01669. TAPASIN.
    PROSITEiPS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O15533-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKSLSLLLAV ALGLATAVSA GPAVIECWFV EDASGKGLAK RPGALLLRQG    50
    PGEPPPRPDL DPELYLSVHD PAGALQAAFR RYPRGAPAPH CEMSRFVPLP 100
    ASAKWASGLT PAQNCPRALD GAWLMVSISS PVLSLSSLLR PQPEPQQEPV 150
    LITMATVVLT VLTHTPAPRV RLGQDALLDL SFAYMPPTSE AASSLAPGPP 200
    PFGLEWRRQH LGKGHLLLAA TPGLNGQMPA AQEGAVAFAA WDDDEPWGPW 250
    TGNGTFWLPR VQPFQEGTYL ATIHLPYLQG QVTLELAVYK PPKVSLMPAT 300
    LARAAPGEAP PELLCLVSHF YPSGGLEVEW ELRGGPGGRS QKAEGQRWLS 350
    ALRHHSDGSV SLSGHLQPPP VTTEQHGARY ACRIHHPSLP ASGRSAEVTL 400
    EVAGLSGPSL EDSVGLFLSA FLLLGLFKAL GWAAVYLSTC KDSKKKAE 448
    Length:448
    Mass (Da):47,626
    Last modified:January 1, 1998 - v1
    Checksum:i7340549519B288AD
    GO
    Isoform 2 (identifier: O15533-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         405-448: LSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE → KSWELCGI

    Note: Due to a partial intron retention.

    Show »
    Length:412
    Mass (Da):43,885
    Checksum:iE50E3F41AD7E7EA8
    GO
    Isoform 3 (identifier: O15533-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         446-448: KAE → VQCSTSLYLSLVTLSPHPISKPMEGGCWCGRQNLGLEFTLIWVKTWHYILTVGLFEHAT

    Note: No experimental confirmation available.

    Show »
    Length:504
    Mass (Da):53,943
    Checksum:iBEF063064284DE16
    GO
    Isoform 4 (identifier: O15533-4) [UniParc]FASTAAdd to Basket

    Also known as: tpsnDeltaEx3

    The sequence of this isoform differs from the canonical sequence as follows:
         70-156: Missing.

    Show »
    Length:361
    Mass (Da):38,365
    Checksum:iE049AA2C6F0B4DED
    GO

    Sequence cautioni

    The sequence AAD32924.2 differs from that shown. Reason: Probable cloning artifact.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti274 – 2741H → Y in AAH80574. (PubMed:15489334)Curated
    Sequence conflicti296 – 2961L → P in ACD68200. (PubMed:20600451)Curated
    Sequence conflicti412 – 4121D → N in AAD32924. (PubMed:14668790)Curated

    Polymorphismi

    The 2 alleles of TAPBP; TAPBP*01 (Tapasin*01) (shown here) and TAPBP*02 (Tapasin*02); are in linkage disequilibria with the HLA-DRB1 locus in a Japanese population.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti260 – 2601R → T in allele TAPBP*02. 3 Publications
    Corresponds to variant rs2071888 [ dbSNP | Ensembl ].
    VAR_010253

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei70 – 15687Missing in isoform 4. 1 PublicationVSP_044455Add
    BLAST
    Alternative sequencei405 – 44844LSGPS…KKKAE → KSWELCGI in isoform 2. 1 PublicationVSP_002577Add
    BLAST
    Alternative sequencei446 – 4483KAE → VQCSTSLYLSLVTLSPHPIS KPMEGGCWCGRQNLGLEFTL IWVKTWHYILTVGLFEHAT in isoform 3. 1 PublicationVSP_017055

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y13582 mRNA. Translation: CAA73909.1.
    AF009510 mRNA. Translation: AAC20076.1.
    AB010639 mRNA. Translation: BAA28757.1.
    AB012622 Genomic DNA. Translation: BAA28758.1.
    AB012920 Genomic DNA. Translation: BAA28759.1.
    AF029750 mRNA. Translation: AAB82949.1.
    AF067286 mRNA. Translation: AAD32924.2. Sequence problems.
    AF314222 mRNA. Translation: AAG33061.1.
    EU693375 mRNA. Translation: ACD68200.1.
    BX248088 Genomic DNA. Translation: CAI41784.1.
    AL662827 Genomic DNA. Translation: CAM24888.1.
    AL662820 Genomic DNA. Translation: CAM25472.1.
    BX248088 Genomic DNA. Translation: CAM25703.1.
    CR759817 Genomic DNA. Translation: CAQ08029.1.
    CR759817 Genomic DNA. Translation: CAQ08031.1.
    CR759786 Genomic DNA. Translation: CAQ08259.1.
    CR759786 Genomic DNA. Translation: CAQ08261.1.
    Z97183 Genomic DNA. No translation available.
    Z97184 Genomic DNA. No translation available.
    CH471081 Genomic DNA. Translation: EAX03717.1.
    BC080574 mRNA. Translation: AAH80574.1.
    CCDSiCCDS34426.1. [O15533-1]
    CCDS34427.2. [O15533-4]
    CCDS34428.2. [O15533-3]
    RefSeqiNP_003181.3. NM_003190.4.
    NP_757345.2. NM_172208.2.
    NP_757346.2. NM_172209.2.
    UniGeneiHs.370937.

    Genome annotation databases

    EnsembliENST00000374572; ENSP00000363700; ENSG00000112493. [O15533-1]
    ENST00000383066; ENSP00000372543; ENSG00000206208.
    ENST00000383197; ENSP00000372684; ENSG00000206281. [O15533-3]
    ENST00000383198; ENSP00000372685; ENSG00000206281. [O15533-1]
    ENST00000395114; ENSP00000378546; ENSG00000112493. [O15533-3]
    ENST00000417059; ENSP00000402087; ENSG00000236490. [O15533-1]
    ENST00000434618; ENSP00000395701; ENSG00000231925.
    ENST00000456807; ENSP00000407195; ENSG00000236490. [O15533-3]
    GeneIDi6892.
    KEGGihsa:6892.
    UCSCiuc003odx.2. human. [O15533-1]
    uc003odz.3. human. [O15533-3]
    uc010jut.2. human. [O15533-4]
    uc011drc.2. human. [O15533-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    TAPBPbase

    TAPBP mutation db

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y13582 mRNA. Translation: CAA73909.1 .
    AF009510 mRNA. Translation: AAC20076.1 .
    AB010639 mRNA. Translation: BAA28757.1 .
    AB012622 Genomic DNA. Translation: BAA28758.1 .
    AB012920 Genomic DNA. Translation: BAA28759.1 .
    AF029750 mRNA. Translation: AAB82949.1 .
    AF067286 mRNA. Translation: AAD32924.2 . Sequence problems.
    AF314222 mRNA. Translation: AAG33061.1 .
    EU693375 mRNA. Translation: ACD68200.1 .
    BX248088 Genomic DNA. Translation: CAI41784.1 .
    AL662827 Genomic DNA. Translation: CAM24888.1 .
    AL662820 Genomic DNA. Translation: CAM25472.1 .
    BX248088 Genomic DNA. Translation: CAM25703.1 .
    CR759817 Genomic DNA. Translation: CAQ08029.1 .
    CR759817 Genomic DNA. Translation: CAQ08031.1 .
    CR759786 Genomic DNA. Translation: CAQ08259.1 .
    CR759786 Genomic DNA. Translation: CAQ08261.1 .
    Z97183 Genomic DNA. No translation available.
    Z97184 Genomic DNA. No translation available.
    CH471081 Genomic DNA. Translation: EAX03717.1 .
    BC080574 mRNA. Translation: AAH80574.1 .
    CCDSi CCDS34426.1. [O15533-1 ]
    CCDS34427.2. [O15533-4 ]
    CCDS34428.2. [O15533-3 ]
    RefSeqi NP_003181.3. NM_003190.4.
    NP_757345.2. NM_172208.2.
    NP_757346.2. NM_172209.2.
    UniGenei Hs.370937.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3F8U X-ray 2.60 B/D 1-401 [» ]
    ProteinModelPortali O15533.
    SMRi O15533. Positions 21-401.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112755. 12 interactions.
    IntActi O15533. 7 interactions.
    MINTi MINT-4053688.

    PTM databases

    PhosphoSitei O15533.

    Proteomic databases

    MaxQBi O15533.
    PaxDbi O15533.
    PRIDEi O15533.

    Protocols and materials databases

    DNASUi 6892.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000374572 ; ENSP00000363700 ; ENSG00000112493 . [O15533-1 ]
    ENST00000383066 ; ENSP00000372543 ; ENSG00000206208 .
    ENST00000383197 ; ENSP00000372684 ; ENSG00000206281 . [O15533-3 ]
    ENST00000383198 ; ENSP00000372685 ; ENSG00000206281 . [O15533-1 ]
    ENST00000395114 ; ENSP00000378546 ; ENSG00000112493 . [O15533-3 ]
    ENST00000417059 ; ENSP00000402087 ; ENSG00000236490 . [O15533-1 ]
    ENST00000434618 ; ENSP00000395701 ; ENSG00000231925 .
    ENST00000456807 ; ENSP00000407195 ; ENSG00000236490 . [O15533-3 ]
    GeneIDi 6892.
    KEGGi hsa:6892.
    UCSCi uc003odx.2. human. [O15533-1 ]
    uc003odz.3. human. [O15533-3 ]
    uc010jut.2. human. [O15533-4 ]
    uc011drc.2. human. [O15533-2 ]

    Organism-specific databases

    CTDi 6892.
    GeneCardsi GC06M033267.
    GC06Mj33189.
    GC06Mk33245.
    GC06Mm33437.
    GC06Mn33196.
    H-InvDB HIX0058157.
    HIX0166135.
    HIX0166410.
    HGNCi HGNC:11566. TAPBP.
    HPAi HPA007066.
    MIMi 601962. gene.
    neXtProti NX_O15533.
    Orphaneti 34592. Immunodeficiency by defective expression of HLA class 1.
    PharmGKBi PA36331.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG41000.
    HOVERGENi HBG005156.
    KOi K08058.
    OMAi YLATVHL.
    PhylomeDBi O15533.
    TreeFami TF334274.

    Enzyme and pathway databases

    Reactomei REACT_111178. ER-Phagosome pathway.
    REACT_75795. Antigen Presentation: Folding, assembly and peptide loading of class I MHC.

    Miscellaneous databases

    ChiTaRSi TAPBP. human.
    EvolutionaryTracei O15533.
    GeneWikii Tapasin.
    GenomeRNAii 6892.
    NextBioi 26935.
    PROi O15533.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O15533.
    Bgeei O15533.
    Genevestigatori O15533.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003597. Ig_C1-set.
    IPR008056. Tapasin.
    [Graphical view ]
    Pfami PF07654. C1-set. 1 hit.
    [Graphical view ]
    PRINTSi PR01669. TAPASIN.
    PROSITEi PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and functional characterization of a subunit of the transporter associated with antigen processing."
      Li S., Sjoegren H.-O., Hellman U., Pettersson R.F., Wang P.
      Proc. Natl. Acad. Sci. U.S.A. 94:8708-8713(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE.
      Tissue: Lymphoblast.
    2. "A critical role for tapasin in the assembly and function of multimeric MHC class I-TAP complexes."
      Ortmann B., Copeman J., Lehner P.J., Sadasivan B., Herberg J.A., Grandea A.G., Riddell S.R., Tampe R., Spies T., Trowsdale J., Cresswell P.
      Science 277:1306-1309(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: B-cell.
    3. "Genomic analysis of the Tapasin gene, located close to the TAP loci in the MHC."
      Herberg J.A., Sgouros J., Jones T., Copeman J., Humphray S.J., Sheer D., Cresswell P., Beck S., Trowsdale J.
      Eur. J. Immunol. 28:459-467(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. "TAPASIN, DAXX, RGL2, HKE2 and four new genes (BING 1, 3 to 5) form a dense cluster at the centromeric end of the MHC."
      Herberg J.A., Beck S., Trowsdale J.
      J. Mol. Biol. 277:839-857(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    5. "Polymorphism of TAPASIN and its linkage disequilibria with HLA class II genes in the Japanese population."
      Furukawa H., Kashiwase K., Yabe T., Ishikawa Y., Akaza T., Tadokoro K., Tohma S., Inoue T., Tokunaga K., Yamamoto K., Juji T.
      Tissue Antigens 52:279-281(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANT THR-260.
      Tissue: Lymphocyte.
    6. "Granulocyte-macrophage colony-stimulating factor modulates tapasin expression in human neutrophils."
      El Ouakfaoui S., Heitz D., Paquin R., Beaulieu A.D.
      J. Leukoc. Biol. 65:205-210(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Neutrophil.
    7. "Generation of a functional, soluble tapasin protein from an alternatively spliced mRNA."
      Gao B., Williams A., Sewell A., Elliott T.
      Genes Immun. 5:101-108(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: B-cell.
    8. "Identification of an alternate splice form of tapasin in human melanoma."
      Belicha-Villanueva A., Golding M., McEvoy S., Sarvaiya N., Cresswell P., Gollnick S.O., Bangia N.
      Hum. Immunol. 71:1018-1026(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), ALTERNATIVE SPLICING.
      Tissue: Melanoma.
    9. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-260.
    10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-260.
    11. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Prostate.
    12. "The N-terminal region of tapasin is required to stabilize the MHC class I loading complex."
      Bangia N., Lehner P.J., Hughes E.A., Surman M., Cresswell P.
      Eur. J. Immunol. 29:1858-1870(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: MUTAGENESIS, DOMAIN CHARACTERIZATION.
    13. "Tapasin is required for efficient peptide binding to transporter associated with antigen processing."
      Li S., Paulsson K.M., Chen S., Sjoegren H.-O., Wang P.
      J. Biol. Chem. 275:1581-1586(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    14. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-253.
      Tissue: Liver.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. "Insights into MHC class I peptide loading from the structure of the tapasin-ERp57 thiol oxidoreductase heterodimer."
      Dong G., Wearsch P.A., Peaper D.R., Cresswell P., Reinisch K.M.
      Immunity 30:21-32(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 1-401 IN COMPLEX WITH PDIA3, SUBUNIT, INTERACTION WITH PDIA3, GLYCOSYLATION AT ASN-253, DISULFIDE BONDS.

    Entry informationi

    Entry nameiTPSN_HUMAN
    AccessioniPrimary (citable) accession number: O15533
    Secondary accession number(s): A2AB91
    , A2ABC0, B0V003, B0V0A6, B2ZUA4, E9PGM2, O15210, O15272, Q5STJ8, Q5STK6, Q5STQ5, Q5STQ6, Q66K65, Q96KK7, Q9HAN8, Q9UEE0, Q9UEE4, Q9UIZ6, Q9Y6K2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 24, 2001
    Last sequence update: January 1, 1998
    Last modified: October 1, 2014
    This is version 148 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3